Sequences
EST Library Info
eep1Foetus 50 days, epidermis
Clusters
Oligos
SNPs

Gene ID ENSG00000037280 (click for geneview)
Transcript ID ENST00000261937(link to ensembl)
Symbol FLT4
Localtion Chromosome:5:179962143:180009171:-1 band: 5q35.3
Description Vascular endothelial growth factor receptor 3 precursor (EC 2.7.1.112) (VEGFR-3) (Tyrosine-protein kinase receptor FLT4). [Source:Uniprot/SWISSPROT;Acc:P35916]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------><-----------------------------------------
-M--Q--R--G--A--A--L--C--L--R--L--W--L--C--L--G--L--L--D--G--L--V--S--G--Y--S--M--T--P--P--T--L--N--
ATGCAGCGGGGCGCCGCGCTGTGCCTGCGACTGTGGCTCTGCCTGGGACTCCTGGACGGCCTGGTGAGTGGCTACTCCATGACCCCCCCGACCTTGAACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------><--------------------------------------------
I--T--E--E--S--H--V--I--D--T--G--D--S--L--S--I--S--C--R--G--Q--H--P--L--E--W--A--W--P--G--A--Q--E--A
TCACGGAGGAGTCACACGTCATCGACACCGGTGACAGCCTGTCCATCTCCTGCAGGGGACAGCACCCCCTCGAGTGGGCTTGGCCAGGAGCTCAGGAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--A--T--G--D--K--D--S--E--D--T--G--V--V--R--D--C--E--G--T--D--A--R--P--Y--C--K--V--L--L--L--H--E-
GCCAGCCACCGGAGACAAGGACAGCGAGGACACGGGGGTGGTGCGAGACTGCGAGGGCACAGACGCCAGGCCCTACTGCAAGGTGTTGCTGCTGCACGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------->
-V--H--A--N--D--T--G--S--Y--V--C--Y--Y--K--Y--I--K--A--R--I--E--G--T--T--A--A--S--S--Y--V--F--V--R--
GTACATGCCAACGACACAGGCAGCTACGTCTGCTACTACAAGTACATCAAGGCACGCATCGAGGGCACCACGGCCGCCAGCTCCTACGTGTTCGTGAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

<---------------------------------------------------------------------------------------------------
D--F--E--Q--P--F--I--N--K--P--D--T--L--L--V--N--R--K--D--A--M--W--V--P--C--L--V--S--I--P--G--L--N--V
ACTTTGAGCAGCCATTCATCAACAAGCCTGACACGCTCTTGGTCAACAGGAAGGACGCCATGTGGGTGCCCTGTCTGGTGTCCATCCCCGGCCTCAATGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><--------------------------------------------------------------------------------------
--T--L--R--S--Q--S--S--V--L--W--P--D--G--Q--E--V--V--W--D--D--R--R--G--M--L--V--S--T--P--L--L--H--D-
CACGCTGCGCTCGCAAAGCTCGGTGCTGTGGCCAGACGGGCAGGAGGTGGTGTGGGATGACCGGCGGGGCATGCTCGTGTCCACGCCACTGCTGCACGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------><-----------------------
-A--L--Y--L--Q--C--E--T--T--W--G--D--Q--D--F--L--S--N--P--F--L--V--H--I--T--G--N--E--L--Y--D--I--Q--
GCCCTGTACCTGCAGTGCGAGACCACCTGGGGAGACCAGGACTTCCTTTCCAACCCCTTCCTGGTGCACATCACAGGCAACGAGCTCTATGACATCCAGC
                                                                              ::::::::::::::::: ::::
------------------------------------------------------------------------------AACGAGCTCTATGACAT-CAGC
-------------------------------------------------------------------------------N--E--L--Y--D--I--Q--

----------------------------------------------------------------------------------------------------
L--L--P--R--K--S--L--E--L--L--V--G--E--K--L--V--L--N--C--T--V--W--A--E--F--N--S--G--V--T--F--D--W--D
TGTTGCCCAGGAAGTCGCTGGAGCTGCTGGTAGGGGAGAAGCTGGTCCTGAACTGCACCGTGTGGGCTGAGTTTAACTCAGGTGTCACCTTTGACTGGGA
:.:: ::::.:::.::.:::::.:::::::: ::::::::::::::.::::::::::::::::::::.:::::.::::::::.::::::::.::::::::
TATTCCCCAAGAAATCACTGGAACTGCTGGTTGGGGAGAAGCTGGTTCTGAACTGCACCGTGTGGGCCGAGTTCAACTCAGGCGTCACCTTCGACTGGGA
L--F--P--K--K--S--L--E--L--L--V--G--E--K--L--V--L--N--C--T--V--W--A--E--F--N--S--G--V--T--F--D--W--D

------------------><--------------------------------------------------------------------------------
--Y--P--G--K--Q--A--E--R--G--K--W--V--P--E--R--R--S--Q--Q--T--H--T--E--L--S--S--I--L--T--I--H--N--V-
CTACCCAGGGAAGCAGGCAGAGCGGGGTAAGTGGGTGCCCGAGCGACGCTCCCAGCAGACCCACACAGAACTCTCCAGCATCCTGACCATCCACAACGTC
:::.::::::      :::::::::::::.::::::::: :::::.::::::::::::::.:::::.::.:::::::::::::: :::::::::::::::
CTATCCAGGG------GCAGAGCGGGGTAGGTGGGTGCCGGAGCGGCGCTCCCAGCAGACTCACACGGAGCTCTCCAGCATCCTCACCATCCACAACGTC
--Y--P--G--------A--E--R--G--R--W--V--P--E--R--R--S--Q--Q--T--H--T--E--L--S--S--I--L--T--I--H--N--V-

---------------------------------------------------------------------------------------><-----------
-S--Q--H--D--L--G--S--Y--V--C--K--A--N--N--G--I--Q--R--F--R--E--S--T--E--V--I--V--H--E--N--P--F--I--
AGCCAGCACGACCTGGGCTCGTATGTGTGCAAGGCCAACAACGGCATCCAGCGATTTCGGGAGAGCACCGAGGTCATTGTGCATGAAAATCCCTTCATCA
::::::::::::.:::: .:.::.:::::: ::::::::::.::::::::::.:::.:.:::::::::.:::                            
AGCCAGCACGACTTGGGGCCATACGTGTGCCAGGCCAACAATGGCATCCAGCAATTCCAGGAGAGCACTGAG----------------------------
-S--Q--H--D--L--G--P--Y--V--C--Q--A--N--N--G--I--Q--Q--F--Q--E--S--T--E-----------------------------

----------------------------------------------------------------------------------------------------
S--V--E--W--L--K--G--P--I--L--E--A--T--A--G--D--E--L--V--K--L--P--V--K--L--A--A--Y--P--P--P--E--F--Q
GCGTCGAGTGGCTCAAAGGACCCATCCTGGAGGCCACGGCAGGAGACGAGCTGGTGAAGCTGCCCGTGAAGCTGGCAGCGTACCCCCCGCCCGAGTTCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
--W--Y--K--D--G--K--A--L--S--G--R--H--S--P--H--A--L--V--L--K--E--V--T--E--A--S--T--G--T--Y--T--L--A-
GTGGTACAAGGATGGAAAGGCACTGTCCGGGCGCCACAGTCCACATGCCCTGGTGCTCAAGGAGGTGACAGAGGCCAGCACAGGCACCTACACCCTCGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------><--------------------------------------
-L--W--N--S--A--A--G--L--R--R--N--I--S--L--E--L--V--V--N--V--P--P--Q--I--H--E--K--E--A--S--S--P--S--
CTGTGGAACTCCGCTGCTGGCCTGAGGCGCAACATCAGCCTGGAGCTGGTGGTGAATGTGCCCCCCCAGATACATGAGAAGGAGGCCTCCTCCCCCAGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--Y--S--R--H--S--R--Q--A--L--T--C--T--A--Y--G--V--P--L--P--L--S--I--Q--W--H--W--R--P--W--T--P--C--K
TCTACTCGCGTCACAGCCGCCAGGCCCTCACCTGCACGGCCTACGGGGTGCCCCTGCCTCTCAGCATCCAGTGGCACTGGCGGCCCTGGACACCCTGCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
--M--F--A--Q--R--S--L--R--R--R--Q--Q--Q--D--L--M--P--Q--C--R--D--W--R--A--V--T--T--Q--D--A--V--N--P-
GATGTTTGCCCAGCGTAGTCTCCGGCGGCGGCAGCAGCAAGACCTCATGCCACAGTGCCGTGACTGGAGGGCGGTGACCACGCAGGATGCCGTGAACCCC
                         ::: :::::::: .:::::  :::::::::::::: :::::::::: :::::::::::::::::::.:.::::::
-------------------------CGGAGGCAGCAGAGAGACCGAATGCCACAGTGCCGGGACTGGAGGGAGGTGACCACGCAGGATGCCATAAACCCC
--------------------------R--R--Q--Q--R--D--R--M--P--Q--C--R--D--W--R--E--V--T--T--Q--D--A--I--N--P-

--------------------------------------------------><------------------------------------------------
-I--E--S--L--D--T--W--T--E--F--V--E--G--K--N--K--T--V--S--K--L--V--I--Q--N--A--N--V--S--A--M--Y--K--
ATCGAGAGCCTGGACACCTGGACCGAGTTTGTGGAGGGAAAGAATAAGACTGTGAGCAAGCTGGTGATCCAGAATGCCAACGTGTCTGCCATGTACAAGT
::.::::::::::::::::::::.:::::::::::::: ::::::::::: :::::::::::::: ::::::.:::::::::::::::::::::::::::
ATTGAGAGCCTGGACACCTGGACTGAGTTTGTGGAGGGCAAGAATAAGACGGTGAGCAAGCTGGTTATCCAGGATGCCAACGTGTCTGCCATGTACAAGT
-I--E--S--L--D--T--W--T--E--F--V--E--G--K--N--K--T--V--S--K--L--V--I--Q--D--A--N--V--S--A--M--Y--K--

-----------------------------------------------------------><---------------------------------------
C--V--V--S--N--K--V--G--Q--D--E--R--L--I--Y--F--Y--V--T--T--I--P--D--G--F--T--I--E--S--K--P--S--E--E
GTGTGGTCTCCAACAAGGTGGGCCAGGATGAGCGGCTCATCTACTTCTATGTGACCACCATCCCCGACGGCTTCACCATCGAATCCAAGCCATCCGAGGA
:.:::::::.::::::.::::::::::::::::::::::::::::::::.::::::   ::.::.:::::::::: ::: ::::::.::::::: :::::
GCGTGGTCTTCAACAAAGTGGGCCAGGATGAGCGGCTCATCTACTTCTACGTGACC---ATTCCTGACGGCTTCAGCATAGAATCCGAGCCATCAGAGGA
C--V--V--F--N--K--V--G--Q--D--E--R--L--I--Y--F--Y--V--T-----I--P--D--G--F--S--I--E--S--E--P--S--E--E

----------------------------------------------------------------------------------------------------
--L--L--E--G--Q--P--V--L--L--S--C--Q--A--D--S--Y--K--Y--E--H--L--R--W--Y--R--L--N--L--S--T--L--H--D-
GCTACTAGAGGGCCAGCCGGTGCTCCTGAGCTGCCAAGCCGACAGCTACAAGTACGAGCATCTGCGCTGGTACCGCCTCAACCTGTCCACGCTGCACGAT
::. :::::::::::: : :::: :::::::::::..::.::::.:::::  :::::::::::::::::::::::::::::::::::::.::::::.:::
GCCCCTAGAGGGCCAGACCGTGCGCCTGAGCTGCCGGGCTGACAACTACACTTACGAGCATCTGCGCTGGTACCGCCTCAACCTGTCCATGCTGCATGAT
--P--L--E--G--Q--T--V--R--L--S--C--R--A--D--N--Y--T--Y--E--H--L--R--W--Y--R--L--N--L--S--M--L--H--D-

----------------------------------------------------------------------------------------------------
-A--H--G--N--P--L--L--L--D--C--K--N--V--H--L--F--A--T--P--L--A--A--S--L--E--E--V--A--P--G--A--R--H--
GCGCACGGGAACCCGCTTCTGCTCGACTGCAAGAACGTGCATCTGTTCGCCACCCCTCTGGCCGCCAGCCTGGAGGAGGTGGCACCTGGGGCGCGCCACG
::.:::::::::::::: :::::::::::::::::::::::.:: :::::::: :: :: ::::::::::::::.::::. :::                
GCACACGGGAACCCGCTGCTGCTCGACTGCAAGAACGTGCACCTCTTCGCCACGCCGCTTGCCGCCAGCCTGGAAGAGGCTGCA----------------
-A--H--G--N--P--L--L--L--D--C--K--N--V--H--L--F--A--T--P--L--A--A--S--L--E--E--A--A-----------------

----------------------------------------------------------------------------------------------------
A--T--L--S--L--S--I--P--R--V--A--P--E--H--E--G--H--Y--V--C--E--V--Q--D--R--R--S--H--D--K--H--C--H--K
CCACGCTCAGCCTGAGTATCCCCCGCGTCGCGCCCGAGCACGAGGGCCACTATGTGTGCGAAGTGCAAGACCGGCGCAGCCATGACAAGCACTGCCACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------><----------------------------------------------------------------------------
--K--Y--L--S--V--Q--A--L--E--A--P--R--L--T--Q--N--L--T--D--L--L--V--N--V--S--D--S--L--E--M--Q--C--L-
GAAGTACCTGTCGGTGCAGGCCCTGGAAGCCCCTCGGCTCACGCAGAACTTGACCGACCTCCTGGTGAACGTGAGCGACTCGCTGGAGATGCAGTGCTTG
                      ::::::::::: ::::::::.::::::::::: :::::::: :::::::::::.::.:: .:::::::::.::::...
----------------------CTGGAAGCCCCGCGGCTCACACAGAACTTGACGGACCTCCTCGTGAACGTGAGTGATTCCTTGGAGATGCGGTGCCCA
-----------------------L--E--A--P--R--L--T--Q--N--L--T--D--L--L--V--N--V--S--D--S--L--E--M--R--C--P-

---------------------------------------------------------------------><-----------------------------
-V--A--G--A--H--A--P--S--I--V--W--Y--K--D--E--R--L--L--E--E--K--S--G--V--D--L--A--D--S--N--Q--K--L--
GTGGCCGGAGCGCACGCGCCCAGCATCGTGTGGTACAAAGACGAGAGGCTGCTGGAGGAAAAGTCTGGAGTCGACTTGGCGGACTCCAACCAGAAGCTGA
::::::::.:::::::.::::::::::::::::::::::::.::::::::::::: ::::.::      .:::::.::.:::::::::::::::::::::
GTGGCCGGGGCGCACGTGCCCAGCATCGTGTGGTACAAAGATGAGAGGCTGCTGGCGGAAGAG------ATCGACCTGACGGACTCCAACCAGAAGCTGA
-V--A--G--A--H--V--P--S--I--V--W--Y--K--D--E--R--L--L--A--E--E--------I--D--L--T--D--S--N--Q--K--L--

----------------------------------------------------------------------------------------------------
S--I--Q--R--V--R--E--E--D--A--G--R--Y--L--C--S--V--C--N--A--K--G--C--V--N--S--S--A--S--V--A--V--E--G
GCATCCAGCGCGTGCGCGAGGAGGATGCGGGACGCTATCTGTGCAGCGTGTGCAACGCCAAGGGCTGCGTCAACTCCTCCGCCAGCGTGGCCGTGGAAGG
::::: .::::::::::::::::::.::.:: ::::::::.:::::::::::::::::::::::::::::.:::::::::::::::::::: ::::::  
GCATCAGGCGCGTGCGCGAGGAGGACGCAGGCCGCTATCTATGCAGCGTGTGCAACGCCAAGGGCTGCGTTAACTCCTCCGCCAGCGTGGCGGTGGAA--
S--I--R--R--V--R--E--E--D--A--G--R--Y--L--C--S--V--C--N--A--K--G--C--V--N--S--S--A--S--V--A--V--E---

-><-------------------------------------------------------------------------------------------------
--S--E--D--K--G--S--M--E--I--V--I--L--V--G--T--G--V--I--A--V--F--F--W--V--L--L--L--L--I--F--C--N--M-
CTCCGAGGATAAGGGCAGCATGGAGATCGTGATCCTTGTCGGTACCGGCGTCATCGCTGTCTTCTTCTGGGTCCTCCTCCTCCTCATCTTCTGTAACATG
 :::::.::::: ::::::::::::::::::::::::::.::.::::: :: :::::.::::::::::::::::::::::::::::::::::::::::::
-TCCGAAGATAACGGCAGCATGGAGATCGTGATCCTTGTTGGCACCGGAGTGATCGCCGTCTTCTTCTGGGTCCTCCTCCTCCTCATCTTCTGTAACATG
--S--E--D--N--G--S--M--E--I--V--I--L--V--G--T--G--V--I--A--V--F--F--W--V--L--L--L--L--I--F--C--N--M-

--------><------------------------------------------------------------------------------------------
-R--R--P--A--H--A--D--I--K--T--G--Y--L--S--I--I--M--D--P--G--E--V--P--L--E--E--Q--C--E--Y--L--S--Y--
AGGAGGCCGGCCCACGCAGACATCAAGACGGGCTACCTGTCCATCATCATGGACCCCGGGGAGGTGCCTCTGGAGGAGCAATGCGAATACCTGTCCTACG
::::::::..::::.:::::::::::::: ::::::::::::::::::::::::::.:::::.::.:. .::::::::::.::.::::::::::::::.:
AGGAGGCCAACCCATGCAGACATCAAGACTGGCTACCTGTCCATCATCATGGACCCTGGGGAAGTACT-TTGGAGGAGCAGTGTGAATACCTGTCCTATG
-R--R--P--T--H--A--D--I--K--T--G--Y--L--S--I--I--M--D--P--G--E--V--P--L--E--E--Q--C--E--Y--L--S--Y--

-----------------------------------------------><---------------------------------------------------
D--A--S--Q--W--E--F--P--R--E--R--L--H--L--G--R--V--L--G--Y--G--A--F--G--K--V--V--E--A--S--A--F--G--I
ATGCCAGCCAGTGGGAATTCCCCCGAGAGCGGCTGCACCTGGGGAGAGTGCTCGGCTACGGCGCCTTCGGGAAGGTGGTGGAAGCCTCCGCTTTCGGCAT
::::::::::::::::.::::::::.::.::::::::::::                              ::::::::::::::::: ::.::.:::::
ATGCCAGCCAGTGGGAGTTCCCCCGGGAACGGCTGCACCTG------------------------------AAGGTGGTGGAAGCCTCGGCCTTTGGCAT
D--A--S--Q--W--E--F--P--R--E--R--L--H--L--------------------------------K--V--V--E--A--S--A--F--G--I

----------------------------------------------------><----------------------------------------------
--H--K--G--S--S--C--D--T--V--A--V--K--M--L--K--E--G--A--T--A--S--E--H--R--A--L--M--S--E--L--K--I--L-
CCACAAGGGCAGCAGCTGTGACACCGTGGCCGTGAAAATGCTGAAAGAGGGCGCCACGGCCAGCGAGCACCGCGCGCTGATGTCGGAGCTCAAGATCCTC
: ::::.:::::::::::::::::.::::: :::::.:::::::::                                                :::.: 
CAACAAAGGCAGCAGCTGTGACACTGTGGCGGTGAAGATGCTGAAA------------------------------------------------ATCTTA
--N--K--G--S--S--C--D--T--V--A--V--K--M--L--K--------------------------------------------------I--L-

------------------------------------------------------------------><--------------------------------
-I--H--I--G--N--H--L--N--V--V--N--L--L--G--A--C--T--K--P--Q--G--P--L--M--V--I--V--E--F--C--K--Y--G--
ATTCACATCGGCAACCACCTCAACGTGGTCAACCTCCTCGGGGCGTGCACCAAGCCGCAGGGCCCCCTCATGGTGATCGTGGAGTTCTGCAAGTACGGCA
::.::::::::.:::::.::::::::::::::::: :: :::::.:::::::::         ::::::::::::::.::::::::::::::::::::::
ATCCACATCGGTAACCATCTCAACGTGGTCAACCTGCTGGGGGCATGCACCAAG---------CCCCTCATGGTGATTGTGGAGTTCTGCAAGTACGGCA
-I--H--I--G--N--H--L--N--V--V--N--L--L--G--A--C--T--K-----------P--L--M--V--I--V--E--F--C--K--Y--G--

-------------------------------------------------------><-------------------------------------------
N--L--S--N--F--L--R--A--K--R--D--A--F--S--P--C--A--E--K--S--P--E--Q--R--G--R--F--R--A--M--V--E--L--A
ACCTCTCCAACTTCCTGCGCGCCAAGCGGGACGCCTTCAGCCCCTGCGCGGAGAAGTCTCCCGAGCAGCGCGGACGCTTCCGCGCCATGGTGGAGCTCGC
:::: :::::::::.:.:::::::::::::: :::::::.:::::.::::                                                  
ACCTGTCCAACTTCTTACGCGCCAAGCGGGAGGCCTTCAACCCCTACGCG--------------------------------------------------
N--L--S--N--F--L--R--A--K--R--E--A--F--N--P--Y--A---------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--L--D--R--R--R--P--G--S--S--D--R--V--L--F--A--R--F--S--K--T--E--G--G--A--R--R--A--S--P--D--Q--E-
CAGGCTGGATCGGAGGCGGCCGGGGAGCAGCGACAGGGTCCTCTTCGCGCGGTTCTCGAAGACCGAGGGCGGAGCGAGGCGGGCTTCTCCAGACCAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><--------------------------------------------------------------------------------------------
-A--E--D--L--W--L--S--P--L--T--M--E--D--L--V--C--Y--S--F--Q--V--A--R--G--M--E--F--L--A--S--R--K--C--
GCTGAGGACCTGTGGCTGAGCCCGCTGACCATGGAAGATCTTGTCTGCTACAGCTTCCAGGTGGCCAGAGGGATGGAGTTCCTGGCTTCCCGAAAGTGCA
   ::::::::::::::::::::.:::::::::::.::.::::::::::::::::::::::::::: :::::::::::::::::::.::::: :::::::
---GAGGACCTGTGGCTGAGCCCACTGACCATGGAGGACCTTGTCTGCTACAGCTTCCAGGTGGCCCGAGGGATGGAGTTCCTGGCCTCCCGCAAGTGCA
----E--D--L--W--L--S--P--L--T--M--E--D--L--V--C--Y--S--F--Q--V--A--R--G--M--E--F--L--A--S--R--K--C--

-><-------------------------------------------------------------------------------------------------
I--H--R--D--L--A--A--R--N--I--L--L--S--E--S--D--V--V--K--I--C--D--F--G--L--A--R--D--I--Y--K--D--P--D
TCCACAGAGACCTGGCTGCTCGGAACATTCTGCTGTCGGAAAGCGACGTGGTGAAGATCTGTGACTTTGGCCTTGCCCGGGACATCTACAAAGACCCCGA
::::::::::::::::.:::::::::::..:::::::.:::::.::.:::::::::::::::::::::::::: ::.::::::::::::::::::::.::
TCCACAGAGACCTGGCCGCTCGGAACATCTTGCTGTCAGAAAGTGATGTGGTGAAGATCTGTGACTTTGGCCTGGCTCGGGACATCTACAAAGACCCTGA
I--H--R--D--L--A--A--R--N--I--L--L--S--E--S--D--V--V--K--I--C--D--F--G--L--A--R--D--I--Y--K--D--P--D

------------------------><--------------------------------------------------------------------------
--Y--V--R--K--G--S--A--R--L--P--L--K--W--M--A--P--E--S--I--F--D--K--V--Y--T--T--Q--S--D--V--W--S--F-
CTACGTCCGCAAGGGCAGTGCCCGGCTGCCCCTGAAGTGGATGGCCCCTGAAAGCATCTTCGACAAGGTGTACACCACGCAGAGTGACGTGTGGTCCTTT
:::::: ::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.::.:::::::::::.
CTACGTGCGCAAGGGCAGTGCCCGGCTGCCCCTGAAGTGGATGGCCCCTGAGAGCATCTTCGACAAGGTGTACACCACGCAGAGCGATGTGTGGTCCTTC
--Y--V--R--K--G--S--A--R--L--P--L--K--W--M--A--P--E--S--I--F--D--K--V--Y--T--T--Q--S--D--V--W--S--F-

------------------------------------><--------------------------------------------------------------
-G--V--L--L--W--E--I--F--S--L--G--A--S--P--Y--P--G--V--Q--I--N--E--E--F--C--Q--R--L--R--D--G--T--R--
GGGGTGCTTCTCTGGGAGATCTTCTCTCTGGGGGCCTCCCCGTACCCTGGGGTGCAGATCAATGAGGAGTTCTGCCAGCGGCTGAGAGACGGCACAAGGA
::::::::.:::::::::::::::::.:::   ::::::::::::::::::::::::::::::::::::::::::::::::::::.::: :::::  :::
GGGGTGCTCCTCTGGGAGATCTTCTCCCTG---GCCTCCCCGTACCCTGGGGTGCAGATCAATGAGGAGTTCTGCCAGCGGCTGAAAGAGGGCACCCGGA
-G--V--L--L--W--E--I--F--S--L-----A--S--P--Y--P--G--V--Q--I--N--E--E--F--C--Q--R--L--K--E--G--T--R--

------------------------------------><--------------------------------------------------------------
M--R--A--P--E--L--A--T--P--A--I--R--R--I--M--L--N--C--W--S--G--D--P--K--A--R--P--A--F--S--E--L--V--E
TGAGGGCCCCGGAGCTGGCCACTCCCGCCATACGCCGCATCATGCTGAACTGCTGGTCCGGAGACCCCAAGGCGAGACCTGCATTCTCGGAGCTGGTGGA
::::::::::.::::::::::::::.:::                                                                       
TGAGGGCCCCAGAGCTGGCCACTCCTGCC-----------------------------------------------------------------------
M--R--A--P--E--L--A--T--P--A------------------------------------------------------------------------

------------------------------------------><--------------------------------------------------------
--I--L--G--D--L--L--Q--G--R--G--L--Q--E--E--E--E--V--C--M--A--P--R--S--S--Q--S--S--E--E--G--S--F--S-
GATCCTGGGGGACCTGCTCCAGGGCAGGGGCCTGCAAGAGGAAGAGGAGGTCTGCATGGCCCCGCGCAGCTCTCAGAGCTCAGAAGAGGGCAGCTTCTCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------><-------
-Q--V--S--T--M--A--L--H--I--A--Q--A--D--A--E--D--S--P--P--S--L--Q--R--H--S--L--A--A--R--Y--Y--N--W--
CAGGTGTCCACCATGGCCCTACACATCGCCCAGGCTGACGCTGAGGACAGCCCGCCAAGCCTGCAGCGCCACAGCCTGGCCGCCAGGTATTACAACTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--S--F--P--G--C--L--A--R--G--A--E--T--R--G--S--S--R--M--K--T--F--E--E--F--P--M--T--P--T--T--Y--K--G
TGTCCTTTCCCGGGTGCCTGGCCAGAGGGGCTGAGACCCGTGGTTCCTCCAGGATGAAGACATTTGAGGAATTCCCCATGACCCCAACGACCTACAAAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><------------------------------------------------------------------------------------><
--S--V--D--N--Q--T--D--S--G--M--V--L--A--S--E--E--F--E--Q--I--E--S--R--H--R--Q--E--S--G--F--S--C--K-
CTCTGTGGACAACCAGACAGACAGTGGGATGGTGCTGGCCTCGGAGGAGTTTGAGCAGATAGAGAGCAGGCATAGACAAGAAAGCGGCTTCAGCTGTAAA
       ::.::::::::.::::::::::::::::::::::: :::::::::::::.: :.::::.:::.::.:::::::::                  
-------GATAACCAGACGGACAGTGGGATGGTGCTGGCCTCTGAGGAGTTTGAGCGGCTGGAGAACAGACACAGACAAGAA------------------
--------D--N--Q--T--D--S--G--M--V--L--A--S--E--E--F--E--R--L--E--N--R--H--R--Q--E-------------------

----------------------------------------------------------------------------------------------------
-G--P--G--Q--N--V--A--V--T--R--A--H--P--D--S--Q--G--R--R--R--R--P--E--R--G--A--R--G--G--Q--V--F--Y--
GGACCTGGCCAGAATGTGGCTGTGACCAGGGCACACCCTGACTCCCAAGGGAGGCGGCGGCGGCCTGAGCGGGGGGCCCGAGGAGGCCAGGTGTTTTACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------
N--S--E--Y--G--E--L--S--E--P--S--E--E--D--H--C--S--P--S--A--R--V--T--F--F--T--D--N--S--Y--*-
ACAGCGAGTATGGGGAGCTGTCGGAGCCAAGCGAGGAGGACCACTGCTCCCCGTCTGCCCGCGTGACTTTCTTCACAGACAACAGCTACTAA
                                                                                            
--------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000877304
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------AACGAGCTCTATGAccAGCTAT
TCCCCAAGAAATCACTGGAACTGCTGGTTGGGGAGAAGCTGGTTCTGAACTGCACCGTGTGGGCCGAGTTCAACTCAGGCGTCACCTTCGACTGGGACTA
TCCAGGG------GCAGAGCGGGGTAGGTGGGTGCCGGAGCGGCGCTCCCAGCAGACTCACACGGAGCTCTCCAGCATCCTCACCATCCACAACGTCAGC
CAGCACGACTTGGGGCCATACGTGTGCCAGGCCAACAATGGCATCCAGCAATTCCAGGAGAGCACTGAG-------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------CGGAGGCAGCAGAGAGACCGAATGCCACAGTGCCGGGACTGGAGGGAGGTGACCACGCAGGATGCCATAAACCCCATT
GAGAGCCTGGACACCTGGACTGAGTTTGTGGAGGGCAAGAATAAGACGGTGAGCAAGCTGGTTATCCAGGATGCCAACGTGTCTGCCATGTACAAGTGCG
TGGTCTTCAACAAAGTGGGCCAGGATGAGCGGCTCATCTACTTCTACGTGACC---ATTCCTGACGGCTTCAGCATAGAATCCGAGCCATCAGAGGAGCC
CCTAGAGGGCCAGACCGTGCGCCTGAGCTGCCGGGCTGACAACTACACTTACGAGCATCTGCGCTGGTACCGCCTCAACCTGTCCATGCTGCATGATGCA
CACGGGAACCCGCTGCTGCTCGACTGCAAGAACGTGCACCTCTTCGCCACGCCGCTTGCCGCCAGCCTGGAAGAGGCTGCA-------------------
----------------------------------------------------------------------------------------------------
-------------------CTGGAAGCCCCGCGGCTCACACAGAACTTGACGGACCTCCTCGTGAACGTGAGTGATTCCTTGGAGATGCGGTGCCCAGTG
GCCGGGGCGCACGTGCCCAGCATCGTGTGGTACAAAGATGAGAGGCTGCTGGCGGAAGAG------ATCGACCTGACGGACTCCAACCAGAAGCTGAGCA
TCAGGCGCGTGCGCGAGGAGGACGCAGGCCGCTATCTATGCAGCGTGTGCAACGCCAAGGGCTGCGTTAACTCCTCCGCCAGCGTGGCGGTGGAA---TC
CGAAGATAACGGCAGCATGGAGATCGTGATCCTTGTTGGCACCGGAGTGATCGCCGTCTTCTTCTGGGTCCTCCTCCTCCTCATCTTCTGTAACATGAGG
AGGCCAACCCATGCAGACATCAAGACTGGCTACCTGTCCATCATCATGGACCCTGGGGAAGTatTGGAGGAGCAGTGTGAATACCTGTCCTATGATGCCA
GCCAGTGGGAGTTCCCCCGGGAACGGCTGCACCTG------------------------------AAGGTGGTGGAAGCCTCGGCCTTTGGCATCAACAA
AGGCAGCAGCTGTGACACTGTGGCGGTGAAGATGCTGAAA------------------------------------------------ATCTTAATCCAC
ATCGGTAACCATCTCAACGTGGTCAACCTGCTGGGGGCATGCACCAAG---------CCCCTCATGGTGATTGTGGAGTTCTGCAAGTACGGCAACCTGT
CCAACTTCTTACGCGCCAAGCGGGAGGCCTTCAACCCCTACGCG--------------------------------------------------------
-------------------------------------------------------------------------------------------------GAG
GACCTGTGGCTGAGCCCACTGACCATGGAGGACCTTGTCTGCTACAGCTTCCAGGTGGCCCGAGGGATGGAGTTCCTGGCCTCCCGCAAGTGCATCCACA
GAGACCTGGCCGCTCGGAACATCTTGCTGTCAGAAAGTGATGTGGTGAAGATCTGTGACTTTGGCCTGGCTCGGGACATCTACAAAGACCCTGACTACGT
GCGCAAGGGCAGTGCCCGGCTGCCCCTGAAGTGGATGGCCCCTGAGAGCATCTTCGACAAGGTGTACACCACGCAGAGCGATGTGTGGTCCTTCGGGGTG
CTCCTCTGGGAGATCTTCTCCCTG---GCCTCCCCGTACCCTGGGGTGCAGATCAATGAGGAGTTCTGCCAGCGGCTGAAAGAGGGCACCCGGATGAGGG
CCCCAGAGCTGGCCACTCCTGCC-----------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-GATAACCAGACGGACAGTGGGATGGTGCTGGCCTCTGAGGAGTTTGAGCGGCTGGAGAACAGACACAGACAAGAA------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------


>BGISUSP0000877304
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------NELYDQLFPKKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPG--AERGRWVPERRSQQTHTELSSILTIHNVS
QHDLGPYVCQANNGIQQFQESTE-----------------------------------------------------------------------------
--------------------------------------------------------------------------RRQQRDRMPQCRDWREVTTQDAINPI
ESLDTWTEFVEGKNKTVSKLVIQDANVSAMYKCVVFNKVGQDERLIYFYVT-IPDGFSIESEPSEEPLEGQTVRLSCRADNYTYEHLRWYRLNLSMLHDA
HGNPLLLDCKNVHLFATPLAASLEEAA----------------------------------------------LEAPRLTQNLTDLLVNVSDSLEMRCPV
AGAHVPSIVWYKDERLLAEE--IDLTDSNQKLSIRRVREEDAGRYLCSVCNAKGCVNSSASVAVE-SEDNGSMEIVILVGTGVIAVFFWVLLLLIFCNMR
RPTHADIKTGYLSIIMDPGEVLEEQCEYLSYDASQWEFPRERLHL----------KVVEASAFGINKGSSCDTVAVKMLK----------------ILIH
IGNHLNVVNLLGACTK---PLMVIVEFCKYGNLSNFLRAKREAFNPYA---------------------------------------------------E
DLWLSPLTMEDLVCYSFQVARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKWMAPESIFDKVYTTQSDVWSFGV
LLWEIFSL-ASPYPGVQINEEFCQRLKEGTRMRAPELATPA-----------------------------------------------------------
-------------------------------------------------------------------DNQTDSGMVLASEEFERLENRHRQE--------
--------------------------------------------------------------