Sequences
EST Library Info
ebs4Foetus 50 days, brain stem
Clusters
Oligos
SNPs

Gene ID ENSG00000113300 (click for geneview)
Transcript ID ENST00000261951(link to ensembl)
Symbol NOCTL_HUMAN
Localtion Chromosome:5:179854174:179937955:1 band: 5q35.3
Description Carbon catabolite repressor protein 4 homolog (EC 3.1.-.-) (Cytoplasmic deadenylase) (CCR4 carbon catabolite repression 4-like) (Nocturnin homolog).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--K--E--K--Y--E--P--P--D--P--R--R--M--Y--T--I--M--S--S--E--E--A--A--N--G--K--K--S--H--W--A--E--
ATGCCCAAAGAAAAATACGAGCCCCCTGACCCTCGGAGGATGTATACAATTATGTCTTCTGAGGAAGCAGCAAATGGAAAGAAATCCCACTGGGCAGAGC
:::::::::::::::::::::::.::::::::::::::::::::.:::::::::::.::.::.::::::::::::::::::::::: ::.::::::::::
ATGCCCAAAGAAAAATACGAGCCTCCTGACCCTCGGAGGATGTACACAATTATGTCCTCCGAAGAAGCAGCAAATGGAAAGAAATCACATTGGGCAGAGC
-M--P--K--E--K--Y--E--P--P--D--P--R--R--M--Y--T--I--M--S--S--E--E--A--A--N--G--K--K--S--H--W--A--E--

-----------><---------------------------------------------------------------------------------------
L--E--I--S--G--K--V--R--S--L--S--A--S--L--W--S--L--T--H--L--T--A--L--H--L--S--D--N--S--L--S--R--I--P
TTGAAATAAGTGGAAAAGTAAGAAGCTTAAGCGCATCTTTGTGGTCACTAACTCACCTGACAGCTTTGCATTTGAGTGACAATTCCCTGTCCCGAATTCC
:::::::::::   :::::::::::::::::: ::::::::::::::::.::::::.:::::::::::.::.:.:::::::::::::::::::: :::::
TTGAAATAAGT---AAAGTAAGAAGCTTAAGCTCATCTTTGTGGTCACTGACTCACTTGACAGCTTTGTATCTAAGTGACAATTCCCTGTCCCGCATTCC
L--E--I--S-----K--V--R--S--L--S--S--S--L--W--S--L--T--H--L--T--A--L--Y--L--S--D--N--S--L--S--R--I--P

--------------------------------------------------------------------------------------------------><
--S--D--I--A--K--L--H--N--L--V--Y--L--D--L--S--S--N--K--I--R--S--L--P--A--E--L--G--N--M--V--S--L--R-
TTCAGACATTGCCAAGCTTCACAATCTGGTGTATTTGGACCTGTCATCTAATAAAATTCGTAGCTTACCCGCAGAACTCGGAAACATGGTATCACTCAGG
:::::::::::::::::::::::::::::::.::.::::.::.:: :::::::::::.:: ::.::::: :::::::::::::::::::::::::::   
TTCAGACATTGCCAAGCTTCACAATCTGGTGCATCTGGATCTATCCTCTAATAAAATCCGGAGTTTACCAGCAGAACTCGGAAACATGGTATCACTC---
--S--D--I--A--K--L--H--N--L--V--H--L--D--L--S--S--N--K--I--R--S--L--P--A--E--L--G--N--M--V--S--L----

------------------------------------------------------------------------------------><--------------
-E--L--H--L--N--N--N--L--L--R--V--L--P--F--E--L--G--K--L--F--Q--L--Q--T--L--G--L--K--G--N--P--L--T--
GAGCTCCATTTAAATAACAACCTGTTACGAGTTCTACCTTTTGAGCTGGGAAAACTGTTTCAGTTGCAGACTTTAGGCCTGAAAGGAAATCCCCTTACCC
::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::: :::::::
GAACTCCATTTAAATAACAACCTGTTACGAGTTCTACCTTTTGAGCTGGGAAAACTGTTTCAGTTGCAGACTTTAGGCCTGAAA---AATCCACTTACCC
-E--L--H--L--N--N--N--L--L--R--V--L--P--F--E--L--G--K--L--F--Q--L--Q--T--L--G--L--K-----N--P--L--T--

-----------------------------------------------------------------------------------------><---------
Q--D--I--L--N--L--Y--Q--E--P--D--G--T--R--R--L--L--N--Y--L--L--D--N--L--S--G--T--A--K--R--I--T--T--E
AGGATATATTGAACCTTTATCAGGAACCAGATGGAACAAGACGGCTGCTGAACTATTTGCTTGATAATTTGTCAGGTACTGCAAAAAGAATTACAACAGA
::::::: ::::::::.:::: ::::::::::::::::::: ::::.:::::::::::::::::::::::: :::::::::::::::::    :::::::
AGGATATTTTGAACCTCTATCTGGAACCAGATGGAACAAGAAGGCTACTGAACTATTTGCTTGATAATTTGGCAGGTACTGCAAAAAGA---TCAACAGA
Q--D--I--L--N--L--Y--L--E--P--D--G--T--R--R--L--L--N--Y--L--L--D--N--L--A--G--T--A--K--R-----S--T--E

----------------------------------------------------------><----------------------------------------
--Q--P--P--P--R--S--W--I--M--L--Q--E--P--D--R--T--R--P--T--A--L--F--S--V--M--C--Y--N--V--L--C--D--K-
ACAACCACCTCCAAGGTCTTGGATTATGTTACAAGAACCAGATAGGACAAGGCCAACTGCCTTGTTTTCTGTCATGTGCTATAATGTTCTTTGTGATAAA
:::::::::::::::.::::::::::::::::::::::::::.::.::  :::::      :::::::::::::::::::::::::::::::::::::::
ACAACCACCTCCAAGATCTTGGATTATGTTACAAGAACCAGACAGAACTCGGCCA------TTGTTTTCTGTCATGTGCTATAATGTTCTTTGTGATAAA
--Q--P--P--P--R--S--W--I--M--L--Q--E--P--D--R--T--R--P--------L--F--S--V--M--C--Y--N--V--L--C--D--K-

----------------------------------------------------------------------------------------------------
-Y--A--T--R--Q--L--Y--G--Y--C--P--S--W--A--L--N--W--D--Y--R--K--K--A--I--I--Q--E--I--L--S--C--N--A--
TATGCGACCCGGCAGTTATACGGCTACTGTCCATCATGGGCGCTAAACTGGGACTACAGGAAAAAGGCCATTATTCAAGAAATCTTGAGCTGCAATGCTG
::::::::::::::::::::.::::::::::::::::::::.                                                          
TATGCGACCCGGCAGTTATATGGCTACTGTCCATCATGGGCA----------------------------------------------------------
-Y--A--T--R--Q--L--Y--G--Y--C--P--S--W--A-----------------------------------------------------------

----------------><----------------------------------------------------------------------------------
D--I--V--S--L--Q--E--V--E--T--E--Q--Y--Y--S--F--F--L--V--E--L--K--E--R--G--Y--N--G--F--F--S--P--K--S
ATATCGTAAGTCTTCAGGAGGTTGAAACGGAACAGTATTACAGTTTTTTTCTGGTAGAGCTGAAAGAACGTGGCTATAATGGATTCTTCAGTCCTAAGTC
                 :::::::::::.:::::::::::::::::::::::::::::.:::::::: ::::::::::.::::::.::.::::::::.::
-----------------GAGGTTGAAACAGAACAGTATTACAGTTTTTTTCTGGTAGAACTGAAAGACCGTGGCTATAGTGGATTTTTTAGTCCTAAATC
------------------E--V--E--T--E--Q--Y--Y--S--F--F--L--V--E--L--K--D--R--G--Y--S--G--F--F--S--P--K--S

-----------------------------------------------------------------------><---------------------------
--R--A--R--T--M--S--E--Q--E--R--K--H--V--D--G--C--A--I--F--F--K--T--E--K--F--T--L--V--Q--K--H--T--V-
TAGAGCTAGGACAATGTCAGAACAAGAAAGGAAACATGTTGATGGCTGTGCAATATTCTTCAAGACAGAAAAATTTACTTTGGTTCAGAAACACACTGTT
::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::         :::::::::::::::::::::
TAGAGCTAGGACAATGTCAGAACAAGAAAGAAAACATGTTGATGGCTGTGCAATATTCTTCAAGACAGAA---------TTGGTTCAGAAACACACTGTT
--R--A--R--T--M--S--E--Q--E--R--K--H--V--D--G--C--A--I--F--F--K--T--E-----------L--V--Q--K--H--T--V-

----------------------------------------------------------------------------------------------------
-E--F--N--Q--L--A--M--A--N--S--E--G--S--E--A--M--L--N--R--V--M--T--K--D--N--I--G--V--A--V--L--L--E--
GAATTTAATCAGCTAGCCATGGCAAATTCTGAGGGGTCTGAAGCTATGCTGAACAGAGTCATGACAAAAGATAACATTGGGGTTGCAGTACTGCTAGAAC
::::::::::::::::: ::::::::::: ::.:::::::::::::::::::::::::::::::::::::::::::::::.::::: :::::::::::::
GAATTTAATCAGCTAGCGATGGCAAATTCAGAAGGGTCTGAAGCTATGCTGAACAGAGTCATGACAAAAGATAACATTGGAGTTGCTGTACTGCTAGAAC
-E--F--N--Q--L--A--M--A--N--S--E--G--S--E--A--M--L--N--R--V--M--T--K--D--N--I--G--V--A--V--L--L--E--

--------------------------><------------------------------------------------------------------------
L--R--K--E--S--I--E--M--P--S--G--K--P--H--L--G--T--E--K--Q--L--I--L--V--A--N--A--H--M--H--W--D--P--E
TTCGGAAGGAATCGATTGAAATGCCGTCCGGAAAGCCACATCTTGGAACAGAAAAACAACTTATTCTTGTGGCTAACGCCCACATGCATTGGGACCCTGA
::::.:::::::.:::::::         :::::::::::::::::::::::::::::::::::::::::::::::.::.::.:::::::::::::::::
TTCGAAAGGAATTGATTGAA---------GGAAAGCCACATCTTGGAACAGAAAAACAACTTATTCTTGTGGCTAATGCTCATATGCATTGGGACCCTGA
L--R--K--E--L--I--E-----------G--K--P--H--L--G--T--E--K--Q--L--I--L--V--A--N--A--H--M--H--W--D--P--E

----------------------------------------------------------------------------------------------------
--Y--S--D--V--K--L--V--Q--T--M--M--F--L--S--E--V--K--N--I--I--D--K--A--S--R--N--L--K--S--S--V--L--G-
ATACTCTGATGTGAAGTTGGTACAAACTATGATGTTCCTCTCAGAAGTGAAGAACATTATTGATAAAGCCTCTCGCAACCTCAAATCCAGTGTTTTGGGA
::::::::::::::::::::: ::::: :::::::::::::::::::::::::::::::::::.:::::.::  : :.:::. :.:::::::: ::::::
ATACTCTGATGTGAAGTTGGTTCAAACGATGATGTTCCTCTCAGAAGTGAAGAACATTATTGACAAAGCTTCAAGAAGCCTTCAGTCCAGTGTATTGGGA
--Y--S--D--V--K--L--V--Q--T--M--M--F--L--S--E--V--K--N--I--I--D--K--A--S--R--S--L--Q--S--S--V--L--G-

---------------------------------------------------------><-----------------------------------------
-E--F--G--T--I--P--L--V--L--C--A--D--L--N--S--L--P--D--S--G--V--V--E--Y--L--S--T--G--G--V--E--T--N--
GAATTTGGAACTATTCCACTTGTGTTATGTGCAGATCTTAATTCTTTGCCAGACTCTGGTGTTGTAGAATATTTGAGCACAGGTGGAGTAGAAACAAATC
:::::::::::::::::::: :::::.:::::::::::::::::::::::.::::::                                           
GAATTTGGAACTATTCCACTGGTGTTGTGTGCAGATCTTAATTCTTTGCCGGACTCT-------------------------------------------
-E--F--G--T--I--P--L--V--L--C--A--D--L--N--S--L--P--D--S--------------------------------------------

----------------------------------------------------------------------------------------------------
H--K--D--F--K--E--L--R--Y--N--E--S--L--T--N--F--S--C--H--G--K--N--G--T--T--N--G--R--I--T--H--G--F--K
ACAAAGACTTTAAGGAGTTGAGGTATAATGAAAGTCTCACAAACTTCAGCTGTCATGGGAAGAATGGAACCACCAATGGAAGGATCACTCATGGTTTCAA
                                                  ::: :::::::.:::::.:: ::::::::::::::::::::.::::::::
--------------------------------------------------TGTAATGGGAAAAATGGGACAACCAATGGAAGGATCACTCACGGTTTCAA
---------------------------------------------------C--N--G--K--N--G--T--T--N--G--R--I--T--H--G--F--K

------------------------------------------------------------><--------------------------------------
--L--Q--S--A--Y--E--S--G--L--M--P--Y--T--N--Y--T--F--D--F--K--G--I--I--D--Y--I--F--Y--S--K--P--Q--L-
GTTACAGAGTGCCTATGAGAGTGGCCTGATGCCTTACACGAATTACACATTTGATTTCAAGGGTATAATAGACTACATTTTCTATTCTAAACCTCAGCTG
:::: :::::::::: :   :::::::::::::::::::.:::::::::::::::::.:::      :::::::::::.:::::::::::::::::::::
GTTAAAGAGTGCCTANGNNNGTGGCCTGATGCCTTACACAAATTACACATTTGATTTTAAG------ATAGACTACATCTTCTATTCTAAACCTCAGCTG
--L--K--S--A--X--X--X--G--L--M--P--Y--T--N--Y--T--F--D--F--K--------I--D--Y--I--F--Y--S--K--P--Q--L-

----------------------------------------------------------------------------------------------------
-N--T--L--G--I--L--G--P--L--D--H--H--W--L--V--E--N--N--I--S--G--C--P--H--P--L--I--P--S--D--H--F--S--
AACACCTTAGGCATCCTGGGCCCTCTGGACCACCACTGGCTGGTTGAGAATAACATCAGTGGCTGCCCGCACCCCCTCATCCCCTCTGACCACTTCTCAC
:::::.:::::::::::::: ::::::::::::::.:::::.:::::::::::.:::::.:: :::::.::::: :::::::::::.:::::::::::::
AACACTTTAGGCATCCTGGGACCTCTGGACCACCATTGGCTAGTTGAGAATAATATCAGCGGATGCCCACACCCACTCATCCCCTCCGACCACTTCTCAC
-N--T--L--G--I--L--G--P--L--D--H--H--W--L--V--E--N--N--I--S--G--C--P--H--P--L--I--P--S--D--H--F--S--

------------------------------------------------------------------------->
L--F--A--Q--L--E--L--L--L--P--F--L--P--Q--V--N--G--I--H--L--P--G--R--R--*-
TTTTTGCACAACTGGAGCTCTTACTGCCTTTCCTGCCCCAAGTCAACGGCATCCACCTTCCTGGCAGGAGGTAG
:::::::::::::::::::::::::::::::::::::::::::.::::::::.::.::::::            
TTTTTGCACAACTGGAGCTCTTACTGCCTTTCCTGCCCCAAGTTAACGGCATTCATCTTCCT------------
L--F--A--Q--L--E--L--L--L--P--F--L--P--Q--V--N--G--I--H--L--P-------------

Pig Consensus Sequence

>BGISUST0000878664
ATGCCCAAAGAAAAATACGAGCCTCCTGACCCTCGGAGGATGTACACAATTATGTCCTCCGAAGAAGCAGCAAATGGAAAGAAATCACATTGGGCAGAGC
TTGAAATAAGT---AAAGTAAGAAGCTTAAGCTCATCTTTGTGGTCACTGACTCACTTGACAGCTTTGTATCTAAGTGACAATTCCCTGTCCCGCATTCC
TTCAGACATTGCCAAGCTTCACAATCTGGTGCATCTGGATCTATCCTCTAATAAAATCCGGAGTTTACCAGCAGAACTCGGAAACATGGTATCACTC---
GAACTCCATTTAAATAACAACCTGTTACGAGTTCTACCTTTTGAGCTGGGAAAACTGTTTCAGTTGCAGACTTTAGGCCTGAAA---AATCCACTTACCC
AGGATATTTTGAACCTCTATCTGGAACCAGATGGAACAAGAAGGCTACTGAACTATTTGCTTGATAATTTGGCAGGTACTGCAAAAAGA---TCAACAGA
ACAACCACCTCCAAGATCTTGGATTATGTTACAAGAACCAGACAGAACTCGGCCA------TTGTTTTCTGTCATGTGCTATAATGTTCTTTGTGATAAA
TATGCGACCCGGCAGTTATATGGCTACTGTCCATCATGGGCA----------------------------------------------------------
-----------------GAGGTTGAAACAGAACAGTATTACAGTTTTTTTCTGGTAGAACTGAAAGACCGTGGCTATAGTGGATTTTTTAGTCCTAAATC
TAGAGCTAGGACAATGTCAGAACAAGAAAGAAAACATGTTGATGGCTGTGCAATATTCTTCAAGACAGAA---------TTGGTTCAGAAACACACTGTT
GAATTTAATCAGCTAGCGATGGCAAATTCAGAAGGGTCTGAAGCTATGCTGAACAGAGTCATGACAAAAGATAACATTGGAGTTGCTGTACTGCTAGAAC
TTCGAAAGGAATTGATTGAA---------GGAAAGCCACATCTTGGAACAGAAAAACAACTTATTCTTGTGGCTAATGCTCATATGCATTGGGACCCTGA
ATACTCTGATGTGAAGTTGGTTCAAACGATGATGTTCCTCTCAGAAGTGAAGAACATTATTGACAAAGCTTCAAGAAGCCTTCAGTCCAGTGTATTGGGA
GAATTTGGAACTATTCCACTGGTGTTGTGTGCAGATCTTAATTCTTTGCCGGACTCT-------------------------------------------
--------------------------------------------------TGTAATGGGAAAAATGGGACAACCAATGGAAGGATCACTCACGGTTTCAA
GTTAAAGAGTGCCTANGNNNGTGGCCTGATGCCTTACACAAATTACACATTTGATTTTAAG------ATAGACTACATCTTCTATTCTAAACCTCAGCTG
AACACTTTAGGCATCCTGGGACCTCTGGACCACCATTGGCTAGTTGAGAATAATATCAGCGGATGCCCACACCCACTCATCCCCTCCGACCACTTCTCAC
TTTTTGCACAACTGGAGCTCTTACTGCCTTTCCTGCCCCAAGTTAACGGCATTCATCTTCCT------------


>BGISUSP0000878664
MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEIS-KVRSLSSSLWSLTHLTALYLSDNSLSRIPSDIAKLHNLVHLDLSSNKIRSLPAELGNMVSL-
ELHLNNNLLRVLPFELGKLFQLQTLGLK-NPLTQDILNLYLEPDGTRRLLNYLLDNLAGTAKR-STEQPPPRSWIMLQEPDRTRP--LFSVMCYNVLCDK
YATRQLYGYCPSWA-------------------------EVETEQYYSFFLVELKDRGYSGFFSPKSRARTMSEQERKHVDGCAIFFKTE---LVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELIE---GKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLQSSVLG
EFGTIPLVLCADLNSLPDS-------------------------------CNGKNGTTNGRITHGFKLKSA---GLMPYTNYTFDFK--IDYIFYSKPQL
NTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLELLLPFLPQVNGIHLP----