Sequences
EST Library Info
pigcb5Unavailable
plac4Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000119681 (click for geneview)
Transcript ID ENST00000261978(link to ensembl)
Symbol LTBP2
Localtion Chromosome:14:74034640:74148787:-1 band: 14q24.3
Description Latent transforming growth factor-beta-binding protein 2 precursor (LTBP-2). [Source:Uniprot/SWISSPROT;Acc:Q14767]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--R--P--R--T--K--A--R--S--P--G--R--A--L--R--N--P--W--R--G--F--L--P--L--T--L--A--L--F--V--G--A--G--
ATGAGGCCGCGGACCAAAGCCCGCAGCCCGGGGCGCGCCCTGCGGAACCCCTGGAGAGGCTTCCTGCCGCTCACCCTGGCTCTCTTCGTGGGCGCGGGTC
:::::::: . :::::    :::: :::: :::::::::::: :::::::::::::..::::::::::::::::::::::::::::::::::: .:::::
ATGAGGCCCTCGACCACCCGCCGCTGCCCCGGGCGCGCCCTGAGGAACCCCTGGAGGAGCTTCCTGCCGCTCACCCTGGCTCTCTTCGTGGGCTTGGGTC
-M--R--P--S--T--T--R--R--C--P--G--R--A--L--R--N--P--W--R--S--F--L--P--L--T--L--A--L--F--V--G--L--G--

----------------------------------------------------------------------------------------------------
H--A--Q--R--D--P--V--G--R--Y--E--P--A--G--G--D--A--N--R--L--R--R--P--G--G--S--Y--P--A--A--A--A--A--K
ATGCCCAAAGGGACCCCGTAGGGAGATACGAGCCGGCTGGTGGAGACGCGAATCGACTGCGGCGCCCTGGGGGCAGCTACCCGGCAGCGGCTGCAGCCAA
::::.::.:::::::: ::.::.:::::::::::::::::..:.:::::::::::.:::::::::::.:::::::::.:::: :::::::::::::::::
ATGCTCAGAGGGACCCGGTGGGAAGATACGAGCCGGCTGGCAGGGACGCGAATCGGCTGCGGCGCCCCGGGGGCAGCCACCCCGCAGCGGCTGCAGCCAA
H--A--Q--R--D--P--V--G--R--Y--E--P--A--G--R--D--A--N--R--L--R--R--P--G--G--S--H--P--A--A--A--A--A--K

----------------------------------------------------------------------------------------------------
--V--Y--S--L--F--R--E--Q--D--A--P--V--A--G--L--Q--P--V--E--R--A--Q--P--G--W--G--S--P--R--R--P--T--E-
GGTGTACAGTCTGTTCCGGGAGCAGGACGCGCCTGTCGCGGGCTTGCAGCCCGTGGAGCGGGCCCAGCCGGGCTGGGGGAGCCCCAGGAGGCCCACCGAG
:::::::.::::::::::::: :::::::::.: ::: ::::.:::                                                      
GGTGTACGGTCTGTTCCGGGATCAGGACGCGTCGGTCCCGGGTTTG------------------------------------------------------
--V--Y--G--L--F--R--D--Q--D--A--S--V--P--G--L-------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--E--A--R--R--P--S--R--A--Q--Q--S--R--R--V--Q--P--P--A--Q--T--R--R--S--T--P--L--G--Q--Q--Q--P--A--
GCGGAGGCCAGGAGGCCGTCCCGCGCGCAGCAGTCGCGGCGTGTCCAGCCACCTGCGCAGACCCGGAGAAGCACTCCCCTGGGCCAGCAGCAACCAGCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------><-----
P--R--T--R--A--A--P--A--L--P--R--L--G--T--P--Q--R--S--G--A--A--P--P--T--P--P--R--G--R--L--T--G--R--N
CCCGGACCCGGGCCGCGCCGGCTCTCCCACGCCTGGGGACCCCACAGCGGTCTGGGGCTGCGCCCCCAACCCCGCCGCGAGGGCGGCTCACGGGGAGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------><----------------------------------
--V--C--G--G--Q--C--C--P--G--W--T--T--A--N--S--T--N--H--C--I--K--P--V--C--E--P--P--C--Q--N--R--G--S-
CGTCTGCGGGGGACAGTGCTGCCCAGGATGGACAACAGCAAACAGCACCAACCACTGTATCAAACCCGTTTGCGAGCCGCCGTGCCAGAACCGGGGCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-C--S--R--P--Q--L--C--V--C--R--S--G--F--R--G--A--R--C--E--E--V--I--P--D--E--E--F--D--P--Q--N--S--R--
TGCAGCCGCCCGCAGCTCTGTGTCTGCCGCTCTGGTTTCCGTGGAGCCCGCTGCGAGGAGGTCATTCCCGATGAGGAATTTGACCCCCAGAACTCCAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--A--P--R--R--W--A--E--R--S--P--N--L--R--R--S--S--A--A--G--E--G--T--L--A--R--A--Q--P--P--A--P--Q--S
TGGCACCTCGACGCTGGGCCGAGCGTTCACCCAACCTGCGCAGGAGCAGTGCGGCTGGAGAGGGCACCTTGGCCAGAGCACAGCCGCCAGCACCACAGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------><---------------------------------------------------------------------
--P--P--A--P--Q--S--P--P--A--G--T--L--S--G--L--S--Q--T--H--P--S--Q--Q--H--V--G--L--S--R--T--V--R--L-
GCCGCCCGCACCACAGTCGCCACCAGCTGGGACCCTGAGTGGCCTCAGCCAGACCCACCCTTCCCAGCAGCACGTGGGGTTGTCCCGCACTGTCCGACTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--P--T--A--T--A--S--S--Q--L--S--S--N--A--L--P--P--G--P--G--L--E--Q--R--D--G--T--Q--Q--A--V--P--L--
CACCCGACTGCCACGGCCAGTAGCCAGCTCTCTTCCAACGCCCTGCCCCCGGGACCAGGCCTTGAGCAGAGAGATGGCACCCAACAGGCGGTACCTCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------><------------------------------------------------------------------------------
E--H--P--S--S--P--W--G--L--N--L--T--E--K--I--K--K--I--K--I--V--F--T--P--T--I--C--K--Q--T--C--A--R--G
AGCACCCCTCATCCCCCTGGGGGCTGAACCTCACGGAGAAAATCAAGAAGATCAAGATCGTCTTCACTCCCACCATCTGCAAGCAGACCTGTGCCCGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------><-------
--H--C--A--N--S--C--E--R--G--D--T--T--T--L--Y--S--Q--G--G--H--G--H--D--P--K--S--G--F--R--I--Y--F--C-
ACACTGTGCCAACAGCTGTGAGAGGGGCGACACCACCACCCTGTACAGCCAGGGCGGCCATGGGCACGATCCCAAGTCTGGCTTCCGCATCTATTTCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Q--I--P--C--L--N--G--G--R--C--I--G--R--D--E--C--W--C--P--A--N--S--T--G--K--F--C--H--L--P--I--P--Q--
CAGATCCCCTGCCTGAACGGAGGCCGCTGCATCGGCAGGGACGAATGCTGGTGCCCCGCCAACTCCACCGGGAAGTTCTGCCACCTGCCTATCCCGCAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------><
P--D--R--E--P--P--G--R--G--S--R--P--R--A--L--L--E--A--P--L--K--Q--S--T--F--T--L--P--L--S--N--Q--L--A
CGGACAGGGAGCCTCCAGGGAGGGGGTCCCGCCCCAGGGCCTTGCTGGAAGCCCCACTGAAGCAGTCCACTTTCACACTGCCGCTCTCCAACCAGCTGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--V--N--P--S--L--V--K--V--H--I--H--H--P--P--E--A--S--V--Q--I--H--Q--V--A--Q--V--R--G--G--V--E--E-
CTCCGTGAACCCCTCCCTGGTGAAGGTGCACATTCACCACCCACCCGAGGCCTCAGTGCAGATCCACCAGGTGGCCCAGGTGCGGGGCGGGGTGGAGGAG
 ::::: :::::::::.::::::::::::::::.::::::::.::.:::::::: ::::::.:::::::::::::.:.:::::::::::.::. ::::.:
-TCCGTCAACCCCTCCTTGGTGAAGGTGCACATCCACCACCCGCCTGAGGCCTCCGTGCAGGTCCACCAGGTGGCTCGGGTGCGGGGCGAGGCTGAGGGG
--S--V--N--P--S--L--V--K--V--H--I--H--H--P--P--E--A--S--V--Q--V--H--Q--V--A--R--V--R--G--E--A--E--G-

----------------------------------------------------------------------------------------------------
-A--L--V--E--N--S--V--E--T--R--P--P--P--W--L--P--A--S--P--G--H--S--L--W--D--S--N--N--I--P--A--R--S--
GCCCTAGTGGAGAACAGCGTGGAGACCAGACCCCCGCCCTGGCTGCCTGCCAGCCCTGGCCACAGCCTCTGGGACAGCAACAACATCCCTGCTCGGTCTG
::::. : :::::::::::::::::::::::::.:::::.::.: ::..::.:::::::::::::::.::::..::::::::.::::::..:::::::..
GCCCCCGAGGAGAACAGCGTGGAGACCAGACCCTCGCCCCGGTTCCCCACCGGCCCTGGCCACAGCCCCTGGAGCAGCAACAGCATCCCCACTCGGTCCA
-A--P--E--E--N--S--V--E--T--R--P--S--P--R--F--P--T--G--P--G--H--S--P--W--S--S--N--S--I--P--T--R--S--

-------------------------------------------------------------------------------------><-------------
G--E--P--P--R--P--L--P--P--A--A--P--R--P--R--G--L--L--G--R--C--Y--L--N--T--V--N--G--Q--C--A--N--P--L
GAGAGCCCCCTCGGCCACTGCCCCCAGCAGCACCCAGGCCTCGAGGACTGCTGGGCCGGTGTTACCTGAACACTGTGAACGGACAGTGTGCCAACCCTCT
::::: :.::::::::::..::::::::.:..::: : :.:::.  ::: ::::: :::::.:::::::.:.:::::::.:::::::::::::::::.::
GAGAGGCTCCTCGGCCACCACCCCCAGCGGTGCCCCGTCTTCGGCCACTTCTGGGGCGGTGCTACCTGAGCGCTGTGAATGGACAGTGTGCCAACCCCCT
R--E--A--P--R--P--P--P--P--A--V--P--R--L--R--P--L--L--G--R--C--Y--L--S--A--V--N--G--Q--C--A--N--P--L

----------------------------------------------------------------------------------------><----------
--L--E--L--T--T--Q--E--D--C--C--G--S--V--G--A--F--W--G--V--T--L--C--A--P--C--P--P--R--P--A--S--P--V-
GCTGGAGCTGACTACCCAGGAGGACTGCTGTGGCAGTGTGGGAGCCTTCTGGGGGGTGACTTTGTGTGCCCCATGCCCACCCAGACCAGCCTCCCCGGTG
:::::::::::::.: ::.:::::::::::::::::::::::::::::::::::::::::.:. :::::::: :::::::::::::::   :::::.:::
GCTGGAGCTGACTGCACAAGAGGACTGCTGTGGCAGTGTGGGAGCCTTCTGGGGGGTGACCTCCTGTGCCCCCTGCCCACCCAGACCA---TCCCCAGTG
--L--E--L--T--A--Q--E--D--C--C--G--S--V--G--A--F--W--G--V--T--S--C--A--P--C--P--P--R--P-----S--P--V-

---------------------------------------------------------------><-----------------------------------
-I--E--N--G--Q--L--E--C--P--Q--G--Y--K--R--L--N--L--T--H--C--Q--D--I--N--E--C--L--T--L--G--L--C--K--
ATTGAGAATGGCCAGCTGGAGTGTCCTCAGGGGTACAAGAGACTGAACCTCACTCACTGCCAAGATATCAACGAGTGCTTGACCCTGGGCCTGTGCAAGG
:::::.:::::::::::::::::::: ::::::::::::::::::::::::::::::::: ::   .:::::::::::::::::.:::::::::::.:::
ATTGAAAATGGCCAGCTGGAGTGTCCGCAGGGGTACAAGAGACTGAACCTCACTCACTGCGAA---GTCAACGAGTGCTTGACCTTGGGCCTGTGCGAGG
-I--E--N--G--Q--L--E--C--P--Q--G--Y--K--R--L--N--L--T--H--C--E-----V--N--E--C--L--T--L--G--L--C--E--

--------------------------------------------------------------------------------------><------------
D--A--E--C--V--N--T--R--G--S--Y--L--C--T--C--R--P--G--L--M--L--D--P--S--R--S--R--C--V--S--D--K--A--I
ACGCGGAGTGTGTGAATACCAGGGGCAGCTACCTGTGCACATGCAGACCTGGCCTCATGCTGGATCCATCGCGGAGCCGCTGTGTGTCGGACAAGGCAAT
:: :.:::::.:::::.::::::::::::::::::::::: ::: ::::::::::: :::::::.::.::  ::::::::::.:::   :::::::: .:
ACTCAGAGTGCGTGAACACCAGGGGCAGCTACCTGTGCACCTGCCGACCTGGCCTCCTGCTGGACCCGTCCAGGAGCCGCTGCGTG---GACAAGGCCGT
D--S--E--C--V--N--T--R--G--S--Y--L--C--T--C--R--P--G--L--L--L--D--P--S--R--S--R--C--V-----D--K--A--V

----------------------------------------------------------------------------------------------------
--S--M--L--Q--G--L--C--Y--R--S--L--G--P--G--T--C--T--L--P--L--A--Q--R--I--T--K--Q--I--C--C--C--S--R-
CTCCATGCTGCAGGGACTGTGCTACCGGTCGCTGGGGCCCGGCACCTGCACCCTGCCTTTGGCCCAGCGGATCACCAAGCAGATATGCTGCTGCAGCCGC
:::::::: ::::::.:::::::::::::.:::::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::::::::: 
CTCCATGCAGCAGGGGCTGTGCTACCGGTTGCTGGGGCCCGGCACCTGCGCCCTGCCTCTGGCCCAGCGGATCACCAAGCAGATATGCTGCTGCAGCCGA
--S--M--Q--Q--G--L--C--Y--R--L--L--G--P--G--T--C--A--L--P--L--A--Q--R--I--T--K--Q--I--C--C--C--S--R-

---------------------------------------------------><-----------------------------------------------
-V--G--K--A--W--G--S--E--C--E--K--C--P--L--P--G--T--E--A--F--R--E--I--C--P--A--G--H--G--Y--T--Y--A--
GTGGGCAAAGCATGGGGCAGCGAGTGTGAGAAATGCCCTCTGCCTGGCACAGAGGCCTTCAGAGAGATCTGCCCTGCCGGCCACGGCTACACCTACGCGA
::::::::::: :::::::::.::::::::: .:::::..:::::::::::   :::::: :.::::::::::::::.:::::::::::::::::: :.:
GTGGGCAAAGCCTGGGGCAGCAAGTGTGAGACGTGCCCCTTGCCTGGCACA---GCCTTCCGGGAGATCTGCCCTGCTGGCCACGGCTACACCTACTCAA
-V--G--K--A--W--G--S--K--C--E--T--C--P--L--P--G--T-----A--F--R--E--I--C--P--A--G--H--G--Y--T--Y--S--

----------------------------------------------------------------------------------------------------
S--S--D--I--R--L--S--M--R--K--A--E--E--E--E--L--A--R--P--P--R--E--Q--G--Q--R--S--S--G--A--L--P--G--P
GCTCCGACATCCGCCTGTCCATGAGGAAAGCCGAGGAGGAGGAACTGGCAAGGCCCCCAAGGGAGCAAGGGCAGAGGAGCAGCGGGGCACTGCCCGGGCC
:::: ::::::::::::::::::::::::::::::::::::::::::::  ::::..:: ::::::: : :::::.:::: ..:::.: :.:::.:::::
GCTCAGACATCCGCCTGTCCATGAGGAAAGCCGAGGAGGAGGAACTGGCCCGGCCTTCATGGGAGCATGTGCAGAAGAGCCATGGGACCCCGCCTGGGCC
S--S--D--I--R--L--S--M--R--K--A--E--E--E--E--L--A--R--P--S--W--E--H--V--Q--K--S--H--G--T--P--P--G--P

-------------------------------------------------------------------><------------------><-----------
--A--E--R--Q--P--L--R--V--V--T--D--T--W--L--E--A--G--T--I--P--D--K--G--D--S--Q--A--G--Q--V--T--T--S-
AGCAGAGAGGCAGCCCCTCCGGGTCGTCACGGACACCTGGCTTGAGGCCGGGACCATCCCTGACAAGGGTGACTCTCAGGCTGGCCAGGTCACGACCAGT
:::::: :::::::: :::::::. :.::: :.:::::::.: ::::: ::::::::::::::::::                                 
AGCAGACAGGCAGCCACTCCGGGCAGCCACCGGCACCTGGTTGGAGGCGGGGACCATCCCTGACAAG---------------------------------
--A--D--R--Q--P--L--R--A--A--T--G--T--W--L--E--A--G--T--I--P--D--K----------------------------------

---------------------------><-----------------------------------------------------------------------
-V--T--H--A--P--A--W--V--T--G--N--A--T--T--P--P--M--P--E--Q--G--I--A--E--I--Q--E--E--Q--V--T--P--S--
GTCACTCATGCACCTGCCTGGGTCACAGGGAATGCCACAACCCCACCAATGCCTGAACAGGGGATTGCAGAGATACAGGAAGAACAAGTGACCCCCTCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------><---------------------------------------------------------------------
T--D--V--L--V--T--L--S--T--P--G--I--D--R--C--A--A--G--A--T--N--V--C--G--P--G--T--C--V--N--L--P--D--G
CTGATGTGCTGGTGACCCTGAGCACCCCAGGCATTGACAGATGCGCTGCTGGAGCCACCAACGTCTGTGGCCCTGGAACCTGCGTGAACCTCCCCGATGG
                                :::::::::::.::..::::::::::::::.:::::::::::::::::::.::::::::::: :::::
--------------------------------ATTGACAGATGTGCCACTGGAGCCACCAACATCTGTGGCCCTGGAACCTGTGTGAACCTCCCAGATGG
---------------------------------I--D--R--C--A--T--G--A--T--N--I--C--G--P--G--T--C--V--N--L--P--D--G

----------------------------------------------------------><----------------------------------------
--Y--R--C--V--C--S--P--G--Y--Q--L--H--P--S--Q--A--Y--C--T--D--D--N--E--C--L--R--D--P--C--K--G--K--G-
ATACAGATGTGTCTGCAGCCCTGGCTACCAGCTGCACCCCAGCCAGGCCTACTGCACAGATGACAACGAGTGTCTGAGGGACCCCTGCAAGGGAAAAGGG
:::::.:::..::::::::::.:::::::.:::::::::::::::::::::::::                                             
ATACAAATGCATCTGCAGCCCCGGCTACCGGCTGCACCCCAGCCAGGCCTACTGC---------------------------------------------
--Y--K--C--I--C--S--P--G--Y--R--L--H--P--S--Q--A--Y--C----------------------------------------------

---------------------------------------------------------------------------------------><-----------
-R--C--I--N--R--V--G--S--Y--S--C--F--C--Y--P--G--Y--T--L--A--T--S--G--A--T--Q--E--C--Q--D--I--N--E--
CGCTGCATCAACCGCGTGGGGTCCTACTCCTGCTTCTGCTACCCTGGCTACACTCTGGCCACCTCAGGGGCGACACAGGAGTGTCAAGATATCAATGAGT
                                                                                          :: .:.::::
------------------------------------------------------------------------------------------ATAGACGAGT
-------------------------------------------------------------------------------------------I--D--E--

----------------------------------------------------------------------------------------------------
C--E--Q--P--G--V--C--S--G--G--Q--C--T--N--T--E--G--S--Y--H--C--E--C--D--Q--G--Y--I--M--V--R--K--G--H
GTGAGCAGCCAGGGGTGTGCAGCGGGGGGCAGTGCACCAACACCGAGGGCTCGTACCACTGCGAGTGTGATCAGGGCTACATCATGGTCAGGAAAGGACA
::::.::::::::: :::::::::::::::.:::::::::::: : :::.:: :::::::::::::::::.:::::::::::::::::::::::.:::::
GTGAACAGCCAGGGCTGTGCAGCGGGGGGCGGTGCACCAACACAGTGGGTTCCTACCACTGCGAGTGTGACCAGGGCTACATCATGGTCAGGAAGGGACA
C--E--Q--P--G--L--C--S--G--G--R--C--T--N--T--V--G--S--Y--H--C--E--C--D--Q--G--Y--I--M--V--R--K--G--H

-------><-------------------------------------------------------------------------------------------
--C--Q--D--I--N--E--C--R--H--P--G--T--C--P--D--G--R--C--V--N--S--P--G--S--Y--T--C--L--A--C--E--E--G-
CTGCCAAGATATCAACGAATGCCGTCACCCCGGTACCTGCCCTGATGGGAGATGCGTCAATTCCCCTGGCTCCTACACTTGTCTGGCCTGTGAGGAGGGC
.::::::   :::::::::::::::::::::::.::::::::.:::::: ::::::::::.:::::.::::::::::::::.::: ::::.:::::::::
TTGCCAA---ATCAACGAATGCCGTCACCCCGGCACCTGCCCCGATGGGCGATGCGTCAACTCCCCCGGCTCCTACACTTGCCTGCCCTGCGAGGAGGGC
--C--Q-----I--N--E--C--R--H--P--G--T--C--P--D--G--R--C--V--N--S--P--G--S--Y--T--C--L--P--C--E--E--G-

---------------------------><-----------------------------------------------------------------------
-Y--R--G--Q--S--G--S--C--V--D--V--N--E--C--L--T--P--G--V--C--A--H--G--K--C--T--N--L--E--G--S--F--R--
TACCGGGGCCAGAGTGGGAGCTGTGTAGATGTGAATGAGTGTCTGACTCCCGGGGTCTGTGCCCATGGAAAGTGCACCAACCTAGAAGGCTCCTTCAGAT
::: ::::::::::.:: :::::.:::   :::::.:::::::::::.::.::::::::.::::::::.: :::: .::::::.::.:::::::::::::
TACAGGGGCCAGAGCGGCAGCTGCGTA---GTGAACGAGTGTCTGACCCCTGGGGTCTGCGCCCATGGGACGTGCCTCAACCTGGAGGGCTCCTTCAGAT
-Y--R--G--Q--S--G--S--C--V-----V--N--E--C--L--T--P--G--V--C--A--H--G--T--C--L--N--L--E--G--S--F--R--

--------------------------------------------------><------------------------------------------------
C--S--C--E--Q--G--Y--E--V--T--S--D--E--K--G--C--Q--D--V--D--E--C--A--S--R--A--S--C--P--T--G--L--C--L
GCTCTTGTGAGCAGGGCTATGAGGTCACCTCAGATGAGAAGGGCTGCCAAGATGTGGATGAGTGTGCCAGCCGGGCCTCATGCCCCACAGGCCTCTGCCT
:::::::.::::  ::::::::::::::::::::.:::::::::::::::   :: ::.::::::::::::::::::::.::::::::.:::::::::::
GCTCTTGCGAGCCCGGCTATGAGGTCACCTCAGACGAGAAGGGCTGCCAA---GTCGACGAGTGTGCCAGCCGGGCCTCGTGCCCCACGGGCCTCTGCCT
C--S--C--E--P--G--Y--E--V--T--S--D--E--K--G--C--Q-----V--D--E--C--A--S--R--A--S--C--P--T--G--L--C--L

----------------------------------------------------------------------------><----------------------
--N--T--E--G--S--F--A--C--S--A--C--E--N--G--Y--W--V--N--E--D--G--T--A--C--E--D--L--D--E--C--A--F--P-
CAACACGGAGGGCTCCTTCGCCTGCTCTGCCTGTGAGAACGGGTACTGGGTGAATGAAGACGGCACTGCCTGTGAAGACCTAGATGAGTGTGCCTTCCCG
:::::: ::::::::::::.::::::: :::::.::::..::::::::::::::.::.::.:::::::::::::::   :::::::::::::::::.:::
CAACACCGAGGGCTCCTTCACCTGCTCGGCCTGCGAGAGTGGGTACTGGGTGAACGAGGATGGCACTGCCTGTGAA---CTAGATGAGTGTGCCTTTCCG
--N--T--E--G--S--F--T--C--S--A--C--E--S--G--Y--W--V--N--E--D--G--T--A--C--E-----L--D--E--C--A--F--P-

----------------------------------------------------------------------------------------------------
-G--V--C--P--S--G--V--C--T--N--T--A--G--S--F--S--C--K--D--C--D--G--G--Y--R--P--S--P--L--G--D--S--C--
GGAGTCTGCCCCTCCGGAGTCTGCACCAACACGGCTGGCTCCTTCTCCTGCAAGGACTGCGATGGGGGCTACCGGCCCAGCCCCCTGGGTGACTCCTGTG
:::::::::::::: :::::::::.::::::: ::.::::::::::::::::.::::::::: :.:::::::::::::::: :::::::. :: ::::: 
GGAGTCTGCCCCTCGGGAGTCTGCGCCAACACTGCCGGCTCCTTCTCCTGCAGGGACTGCGAGGAGGGCTACCGGCCCAGCGCCCTGGGCCACACCTGT-
-G--V--C--P--S--G--V--C--A--N--T--A--G--S--F--S--C--R--D--C--E--E--G--Y--R--P--S--A--L--G--H--T--C--

--><------------------------------------------------------------------------------------------------
E--D--V--D--E--C--E--D--P--Q--S--S--C--L--G--G--E--C--K--N--T--V--G--S--Y--Q--C--L--C--P--Q--G--F--Q
AAGATGTGGATGAATGTGAAGACCCCCAGAGCAGCTGCCTGGGAGGCGAGTGCAAGAACACTGTGGGCTCCTACCAGTGCCTCTGTCCCCAGGGCTTCCA
     ::::::::.:::: ::::::::::::::: :::::::::::::::::::::::::: :. ::::::::::::::::::::::::           
-----GTGGATGAGTGTGCAGACCCCCAGAGCAGGTGCCTGGGAGGCGAGTGCAAGAACACGGCCGGCTCCTACCAGTGCCTCTGTCCC-----------
------V--D--E--C--A--D--P--Q--S--R--C--L--G--G--E--C--K--N--T--A--G--S--Y--Q--C--L--C--P------------

-------------------------><-------------------------------------------------------------------------
--L--A--N--G--T--V--C--E--D--V--N--E--C--M--G--E--E--H--C--A--P--H--G--E--C--L--N--S--H--G--S--F--F-
GCTGGCCAATGGCACCGTGTGTGAGGATGTGAATGAGTGCATGGGGGAGGAGCACTGCGCACCCCACGGCGAGTGCCTCAACAGCCACGGGTCTTTCTTC
                            :::.:.:::::..::::.::.:::.:::::::.:: :. ::::::::.:::::::::::::: ::.:: :::
----------------------------GTGGACGAGTGTGTGGGAGAAGAGTACTGCGCGCCACGGGGCGAGTGTCTCAACAGCCACGGCTCCTTGTTC
-----------------------------V--D--E--C--V--G--E--E--Y--C--A--P--R--G--E--C--L--N--S--H--G--S--L--F-

---------------------------------------------------><-----------------------------------------------
-C--L--C--A--P--G--F--V--S--A--E--G--G--T--S--C--Q--D--V--D--E--C--A--T--T--D--P--C--V--G--G--H--C--
TGTCTGTGCGCGCCTGGCTTCGTCAGCGCAGAGGGGGGCACCAGCTGCCAGGATGTGGACGAGTGTGCCACCACAGACCCGTGTGTGGGAGGGCACTGTG
::::: ::::: :: :::::.:.::::::::: ::::::::::::::::::                                                 
TGTCTCTGCGCCCCGGGCTTTGCCAGCGCAGACGGGGGCACCAGCTGCCAG-------------------------------------------------
-C--L--C--A--P--G--F--A--S--A--D--G--G--T--S--C--Q--------------------------------------------------

--------------------------------------------------------------------------><------------------------
V--N--T--E--G--S--F--N--C--L--C--E--T--G--F--Q--P--S--P--E--S--G--E--C--V--D--I--D--E--C--E--D--Y--G
TCAACACCGAGGGCTCCTTCAACTGTCTATGTGAGACTGGCTTCCAGCCCTCCCCAGAGAGTGGAGAGTGTGTGGATATTGACGAGTGTGAGGACTATGG
                                                                                    ::::::::::::  ::
-----------------------------------------------------------------------------------CAGTGTGAGGACTCGGG
------------------------------------------------------------------------------------Q--C--E--D--S--G

----------------------------------------------------------------------------------------------------
--D--P--V--C--G--T--W--K--C--E--N--S--P--G--S--Y--R--C--V--L--G--C--Q--P--G--F--H--M--A--P--N--G--D-
AGACCCGGTGTGTGGCACCTGGAAGTGTGAAAACAGCCCTGGCTCCTACCGCTGTGTTCTGGGCTGCCAGCCTGGCTTCCACATGGCCCCGAACGGAGAC
::::.:::.:::::: .::::::.::::::.:::::::::::::::.:::::::..:.::::::::::::::::::::::::.::::::: .  ::::::
AGACTCGGCGTGTGGGGCCTGGAGGTGTGAGAACAGCCCTGGCTCCCACCGCTGCATCCTGGGCTGCCAGCCTGGCTTCCACGTGGCCCCTGCGGGAGAC
--D--S--A--C--G--A--W--R--C--E--N--S--P--G--S--H--R--C--I--L--G--C--Q--P--G--F--H--V--A--P--A--G--D-

------><--------------------------------------------------------------------------------------------
-C--I--D--I--D--E--C--A--N--D--T--M--C--G--S--H--G--F--C--D--N--T--D--G--S--F--R--C--L--C--D--Q--G--
TGCATTGACATAGACGAGTGCGCCAACGACACCATGTGTGGCAGCCACGGCTTCTGTGACAACACTGATGGCTCCTTCCGCTGCCTCTGTGACCAGGGCT
 :::::   :::::.::::::::::::::.:::.::::::: :::::.:: : :::.::::::::::: ::::::::::::::::::::::::::: :::
GGCATT---ATAGATGAGTGCGCCAACGATACCGTGTGTGGGAGCCATGGATACTGCGACAACACTGAGGGCTCCTTCCGCTGCCTCTGTGACCAGTGCT
-G--I-----I--D--E--C--A--N--D--T--V--C--G--S--H--G--Y--C--D--N--T--E--G--S--F--R--C--L--C--D--Q--C--

--------------------------------><------------------------------------------------------------------
F--E--I--S--P--S--G--W--D--C--V--D--V--N--E--C--E--L--M--L--A--V--C--G--A--A--L--C--E--N--V--E--G--S
TCGAGATCTCTCCCTCAGGCTGGGACTGTGTGGATGTGAACGAGTGTGAGCTTATGCTGGCGGTATGTGGGGCCGCGCTCTGTGAGAACGTGGAGGGCTC
::::::..::  :::: :::::::::::.                                                                       
TCGAGACTTCAGCCTCCGGCTGGGACTGC-----------------------------------------------------------------------
F--E--T--S--A--S--G--W--D--C------------------------------------------------------------------------

----------------------------------------------------------------------------><----------------------
--F--L--C--L--C--A--S--D--L--E--E--Y--D--A--Q--E--G--H--C--R--P--R--G--A--G--G--Q--S--M--S--E--A--P-
CTTCCTGTGCCTCTGTGCCAGTGACCTGGAGGAGTACGATGCCCAGGAGGGGCACTGCCGCCCACGGGGGGCTGGAGGTCAGAGTATGTCTGAGGCCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--G--D--H--A--P--A--P--T--R--M--D--C--Y--S--G--Q--K--G--H--A--P--C--S--S--V--L--G--R--N--T--T--Q--
ACGGGGGACCATGCCCCGGCCCCCACCCGCATGGACTGCTACTCCGGGCAGAAGGGCCATGCGCCCTGCTCCAGTGTCCTGGGCCGGAACACCACACAGG
               :: :.:::::.::::::::: ::.:::::.::::::::::::::  :::::::::::::. :.::::::::::::::::::::::
---------------CCCGTCCCCATCCGCATGGAATGTTACTCTGGGCAGAAGGGCCAGCCGCCCTGCTCCAGCCTTCTGGGCCGGAACACCACACAGG
----------------P--V--P--I--R--M--E--C--Y--S--G--Q--K--G--Q--P--P--C--S--S--L--L--G--R--N--T--T--Q--

--------------------------------------------------------------------><------------------------------
A--E--C--C--C--T--Q--G--A--S--W--G--D--A--C--D--L--C--P--S--E--D--S--A--E--F--S--E--I--C--P--S--G--K
CTGAATGCTGCTGCACCCAGGGCGCTAGCTGGGGAGATGCCTGTGACCTCTGCCCGTCTGAGGACTCAGCTGAATTCAGCGAGATCTGCCCTAGTGGAAA
::::.::::::::::: ::::::.::.::::::::::::::::::::::::::::. :::::::::::   ::::::::::::::::::::::::::.::
CTGAGTGCTGCTGCACNCAGGGCACTGGCTGGGGAGATGCCTGTGACCTCTGCCCAGCTGAGGACTCA---GAATTCAGCGAGATCTGCCCTAGTGGGAA
A--E--C--C--C--X--Q--G--T--G--W--G--D--A--C--D--L--C--P--A--E--D--S-----E--F--S--E--I--C--P--S--G--K

----------------------------------------------------><----------------------------------------------
--G--Y--I--P--V--E--G--A--W--T--F--G--Q--T--M--Y--T--D--A--D--E--C--V--I--F--G--P--G--L--C--P--N--G-
AGGCTACATTCCTGTGGAAGGAGCCTGGACGTTTGGACAGACCATGTACACAGATGCGGATGAGTGTGTGATATTCGGGCCTGGTCTCTGCCCGAACGGC
:::::::.:.:::::::::::::::::::.::::::::::::::.:::::::                                                
AGGCTACGTCCCTGTGGAAGGAGCCTGGATGTTTGGACAGACCACGTACACA------------------------------------------------
--G--Y--V--P--V--E--G--A--W--M--F--G--Q--T--T--Y--T-------------------------------------------------

---------------------------------------------------------------------------------><-----------------
-R--C--L--N--T--V--P--G--Y--V--C--L--C--N--P--G--F--H--Y--D--A--S--H--K--K--C--E--D--H--D--E--C--Q--
CGGTGCCTCAACACCGTGCCTGGTTATGTCTGCCTGTGCAATCCCGGCTTCCACTACGATGCTTCCCACAAGAAGTGTGAGGATCACGATGAGTGCCAGG
                                                                                    :::::.::::::::::
------------------------------------------------------------------------------------CACGACGAGTGCCAGG
-------------------------------------------------------------------------------------H--D--E--C--Q--

----------------------------------------------------------------------------------------------------
D--L--A--C--E--N--G--E--C--V--N--T--E--G--S--F--H--C--F--C--S--P--P--L--T--L--D--L--S--Q--Q--R--C--M
ACCTGGCCTGTGAGAATGGCGAGTGCGTCAACACGGAGGGCTCCTTCCACTGCTTCTGCAGCCCCCCGCTCACCCTGGACCTCAGCCAGCAGCGCTGCAT
:: :::: :::::::::::::::::.:: :::::.::::::::::::::::::::::::::::: :: ::::::::::::::::::::::::::::::.:
ACATGGCGTGTGAGAATGGCGAGTGTGTGAACACAGAGGGCTCCTTCCACTGCTTCTGCAGCCCACCCCTCACCCTGGACCTCAGCCAGCAGCGCTGCGT
D--M--A--C--E--N--G--E--C--V--N--T--E--G--S--F--H--C--F--C--S--P--P--L--T--L--D--L--S--Q--Q--R--C--V

-------------------><-------------------------------------------------------------------------------
--N--S--T--S--S--T--E--D--L--P--D--H--D--I--H--M--D--I--C--W--K--K--V--T--N--D--V--C--S--E--P--L--R-
GAACAGCACCAGCAGCACGGAGGACCTCCCTGACCACGACATCCACATGGACATCTGCTGGAAAAAAGTCACCAATGATGTGTGCAGCGAACCCCTGCGT
::::::::::::.         ::::: :::::::::::::::::::.:::::::::.:::::::::::::::::: ::::::::::: : :::::::..
GAACAGCACCAGT---------GACCTGCCTGACCACGACATCCACACGGACATCTGTTGGAAAAAAGTCACCAATTATGTGTGCAGCCACCCCCTGCAC
--N--S--T--S-----------D--L--P--D--H--D--I--H--T--D--I--C--W--K--K--V--T--N--Y--V--C--S--H--P--L--H-

---------------------------------------------------------------------------------------><-----------
-G--H--R--T--T--Y--T--E--C--C--C--Q--D--G--E--A--W--S--Q--Q--C--A--L--C--P--P--R--S--S--E--V--Y--A--
GGGCACCGCACCACCTACACGGAATGCTGCTGCCAGGACGGCGAGGCCTGGAGCCAGCAGTGTGCTCTGTGTCCCCCGAGGAGCTCTGAGGTCTATGCTC
::::.::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::.:: ::::::::::: :::::::::   :::::.::::
GGGCGCCGCACCACCTACACGGAGTGCTGCTGCCAGGATGGCGAGGCCTGGAGCCAGCAGTGCGCGCTGTGTCCCCCCAGGAGCTCT---GTCTACGCTC
-G--R--R--T--T--Y--T--E--C--C--C--Q--D--G--E--A--W--S--Q--Q--C--A--L--C--P--P--R--S--S-----V--Y--A--

----------------------------------------------------------------------------------------------------
Q--L--C-----N--V--A--R--I--E--A--E--R--E--A--G--V--H--F--R--P--G--Y--E--Y--G--P--G--P--D--D--L--H--Y
AGCTGTGC---AACGTGGCTCGCATTGAGGCAGAGCGGGAGGCCGGGGTCCACTTCCGGCCAGGCTATGAGTATGGCCCCGGGCCCGATGACCTGCACTA
::::::::    :::::::.:: :::::.::::::::::::::.:::::::::::::::::.:::::::::::::::::::::::::: :::::::::::
AGCTGTGCA--TACGTGGCCCGGATTGAAGCAGAGCGGGAGGCTGGGGTCCACTTCCGGCCGGGCTATGAGTATGGCCCCGGGCCCGAGGACCTGCACTA
Q--L--C--\--N--V--A--R--I--E--A--E--R--E--A--G--V--H--F--R--P--G--Y--E--Y--G--P--G--P--E--D--L--H--Y

----------------------------------------------------------------------------------------------------
--S--I--Y--G--P--D--G--A--P--F--Y--N--Y--L--G--P--E--D--T--V--P--E--P--A--F--P--N--T--A--G--H--S--A-
CAGCATCTATGGCCCAGATGGGGCCCCCTTCTACAACTACCTGGGCCCCGAGGACACCGTCCCTGAGCCTGCCTTCCCCAACACAGCCGGTCACTCAGCG
:.:: ::::.:::::::: :::::::::::::::::::::::::::::::::                                                
CGGCCTCTACGGCCCAGAGGGGGCCCCCTTCTACAACTACCTGGGCCCCGAG------------------------------------------------
--G--L--Y--G--P--E--G--A--P--F--Y--N--Y--L--G--P--E-------------------------------------------------

------------------------------------------------------------------------><--------------------------
-D--R--T--P--I--L--E--S--P--L--Q--P--S--E--L--Q--P--H--Y--V--A--S--H--P--E--P--P--A--G--F--E--G--L--
GACCGCACACCCATCCTTGAGTCTCCTTTGCAGCCCTCAGAACTCCAGCCCCACTACGTGGCCAGCCATCCAGAGCCCCCAGCCGGCTTCGAAGGGCTTC
                                                                             :: .::.:::::.::::::::::
---------------------------------------------------------------------------AACCAGGCTGGCTTTGAAGGGCTTC
----------------------------------------------------------------------------N--Q--A--G--F--E--G--L--

----------------------------------------------------------------------------------------------------
Q--A--E--E--C--G--I--L--N--G--C--E--N--G--R--C--V--R--V--R--E--G--Y--T--C--D--C--F--E--G--F--Q--L--D
AGGCGGAGGAGTGCGGCATCCTGAACGGCTGTGAGAATGGCCGCTGTGTGCGCGTGCGGGAGGGCTACACCTGTGACTGTTTTGAGGGCTTCCAGCTGGA
::::.::::::::::::::::::::::::::::: :::::::::::.:::::.::::::::::::::::::::.:::::.::.:::::::::::::::::
AGGCAGAGGAGTGCGGCATCCTGAACGGCTGTGACAATGGCCGCTGCGTGCGTGTGCGGGAGGGCTACACCTGCGACTGCTTCGAGGGCTTCCAGCTGGA
Q--A--E--E--C--G--I--L--N--G--C--D--N--G--R--C--V--R--V--R--E--G--Y--T--C--D--C--F--E--G--F--Q--L--D

----------------------><----------------------------------------------------------------------------
--A--A--H--M--A--C--V--D--V--N--E--C--D--D--L--N--G--P--A--V--L--C--V--H--G--Y--C--E--N--T--E--G--S-
TGCGGCCCACATGGCCTGCGTAGATGTGAATGAGTGTGATGACTTGAACGGGCCTGCTGTGCTCTGTGTCCATGGTTACTGCGAGAACACAGAGGGCTCC
..::::::: ::::::::.      ::::::::::::::::::::::::::::::::::..:::::::::::::::.:::::::::::::.:::::::::
CACGGCCCAGATGGCCTGT------GTGAATGAGTGTGATGACTTGAACGGGCCTGCTGCACTCTGTGTCCATGGTCACTGCGAGAACACGGAGGGCTCC
--T--A--Q--M--A--C--------V--N--E--C--D--D--L--N--G--P--A--A--L--C--V--H--G--H--C--E--N--T--E--G--S-

-------------------------------------------------------------------->
-Y--R--C--H--C--S--P--G--Y--V--A--E--A--G--P--P--H--C--T--A--K--E--*-
TACCGCTGCCACTGCTCCCCGGGATATGTGGCTGAGGCAGGGCCCCCCCACTGCACTGCCAAGGAGTAG
:::::::::::::::.::::.:: :::::::::::.::::: ::::: :::::::::::::::::::::
TACCGCTGCCACTGCCCCCCAGGTTATGTGGCTGAAGCAGGTCCCCCACACTGCACTGCCAAGGAGTAG
-Y--R--C--H--C--P--P--G--Y--V--A--E--A--G--P--P--H--C--T--A--K--E--*-

Pig Consensus Sequence

>BGISUST0000901101
ATGAGGCCCTCGACCACCCGCCGCTGCCCCGGGCGCGCCCTGAGGAACCCCTGGAGGAGCTTCCTGCCGCTCACCCTGGCTCTCTTCGTGGGCTTGGGTC
ATGCTCAGAGGGACCCGGTGGGAAGATACGAGCCGGCTGGCAGGGACGCGAATCGGCTGCGGCGCCCCGGGGGCAGCCACCCCGCAGCGGCTGCAGCCAA
GGTGTACGGTCTGTTCCGGGATCAGGACGCGTCGGTCCCGGGTTTG------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-TCCGTCAACCCCTCCTTGGTGAAGGTGCACATCCACCACCCGCCTGAGGCCTCCGTGCAGGTCCACCAGGTGGCTCGGGTGCGGGGCGAGGCTGAGGGG
GCCCCCGAGGAGAACAGCGTGGAGACCAGACCCTCGCCCCGGTTCCCCACCGGCCCTGGCCACAGCCCCTGGAGCAGCAACAGCATCCCCACTCGGTCCA
GAGAGGCTCCTCGGCCACCACCCCCAGCGGTGCCCCGTCTTCGGCCACTTCTGGGGCGGTGCTACCTGAGCGCTGTGAATGGACAGTGTGCCAACCCCCT
GCTGGAGCTGACTGCACAAGAGGACTGCTGTGGCAGTGTGGGAGCCTTCTGGGGGGTGACCTCCTGTGCCCCCTGCCCACCCAGACCA---TCCCCAGTG
ATTGAAAATGGCCAGCTGGAGTGTCCGCAGGGGTACAAGAGACTGAACCTCACTCACTGCGAA---GTCAACGAGTGCTTGACCTTGGGCCTGTGCGAGG
ACTCAGAGTGCGTGAACACCAGGGGCAGCTACCTGTGCACCTGCCGACCTGGCCTCCTGCTGGACCCGTCCAGGAGCCGCTGCGTG---GACAAGGCCGT
CTCCATGCAGCAGGGGCTGTGCTACCGGTTGCTGGGGCCCGGCACCTGCGCCCTGCCTCTGGCCCAGCGGATCACCAAGCAGATATGCTGCTGCAGCCGA
GTGGGCAAAGCCTGGGGCAGCAAGTGTGAGACGTGCCCCTTGCCTGGCACA---GCCTTCCGGGAGATCTGCCCTGCTGGCCACGGCTACACCTACTCAA
GCTCAGACATCCGCCTGTCCATGAGGAAAGCCGAGGAGGAGGAACTGGCCCGGCCTTCATGGGAGCATGTGCAGAAGAGCCATGGGACCCCGCCTGGGCC
AGCAGACAGGCAGCCACTCCGGGCAGCCACCGGCACCTGGTTGGAGGCGGGGACCATCCCTGACAAG---------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------ATTGACAGATGTGCCACTGGAGCCACCAACATCTGTGGCCCTGGAACCTGTGTGAACCTCCCAGATGG
ATACAAATGCATCTGCAGCCCCGGCTACCGGCTGCACCCCAGCCAGGCCTACTGC---------------------------------------------
------------------------------------------------------------------------------------------ATAGACGAGT
GTGAACAGCCAGGGCTGTGCAGCGGGGGGCGGTGCACCAACACAGTGGGTTCCTACCACTGCGAGTGTGACCAGGGCTACATCATGGTCAGGAAGGGACA
TTGCCAA---ATCAACGAATGCCGTCACCCCGGCACCTGCCCCGATGGGCGATGCGTCAACTCCCCCGGCTCCTACACTTGCCTGCCCTGCGAGGAGGGC
TACAGGGGCCAGAGCGGCAGCTGCGTA---GTGAACGAGTGTCTGACCCCTGGGGTCTGCGCCCATGGGACGTGCCTCAACCTGGAGGGCTCCTTCAGAT
GCTCTTGCGAGCCCGGCTATGAGGTCACCTCAGACGAGAAGGGCTGCCAA---GTCGACGAGTGTGCCAGCCGGGCCTCGTGCCCCACGGGCCTCTGCCT
CAACACCGAGGGCTCCTTCACCTGCTCGGCCTGCGAGAGTGGGTACTGGGTGAACGAGGATGGCACTGCCTGTGAA---CTAGATGAGTGTGCCTTTCCG
GGAGTCTGCCCCTCGGGAGTCTGCGCCAACACTGCCGGCTCCTTCTCCTGCAGGGACTGCGAGGAGGGCTACCGGCCCAGCGCCCTGGGCCACACCTGT-
-----GTGGATGAGTGTGCAGACCCCCAGAGCAGGTGCCTGGGAGGCGAGTGCAAGAACACGGCCGGCTCCTACCAGTGCCTCTGTCCC-----------
----------------------------GTGGACGAGTGTGTGGGAGAAGAGTACTGCGCGCCACGGGGCGAGTGTCTCAACAGCCACGGCTCCTTGTTC
TGTCTCTGCGCCCCGGGCTTTGCCAGCGCAGACGGGGGCACCAGCTGCCAG-------------------------------------------------
-----------------------------------------------------------------------------------CAGTGTGAGGACTCGGG
AGACTCGGCGTGTGGGGCCTGGAGGTGTGAGAACAGCCCTGGCTCCCACCGCTGCATCCTGGGCTGCCAGCCTGGCTTCCACGTGGCCCCTGCGGGAGAC
GGCATT---ATAGATGAGTGCGCCAACGATACCGTGTGTGGGAGCCATGGATACTGCGACAACACTGAGGGCTCCTTCCGCTGCCTCTGTGACCAGTGCT
TCGAGACTTCAGCCTCCGGCTGGGACTGC-----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------CCCGTCCCCATCCGCATGGAATGTTACTCTGGGCAGAAGGGCCAGCCGCCCTGCTCCAGCCTTCTGGGCCGGAACACCACACAGG
CTGAGTGCTGCTGCACNCAGGGCACTGGCTGGGGAGATGCCTGTGACCTCTGCCCAGCTGAGGACTCA---GAATTCAGCGAGATCTGCCCTAGTGGGAA
AGGCTACGTCCCTGTGGAAGGAGCCTGGATGTTTGGACAGACCACGTACACA------------------------------------------------
------------------------------------------------------------------------------------CACGACGAGTGCCAGG
ACATGGCGTGTGAGAATGGCGAGTGTGTGAACACAGAGGGCTCCTTCCACTGCTTCTGCAGCCCACCCCTCACCCTGGACCTCAGCCAGCAGCGCTGCGT
GAACAGCACCAGT---------GACCTGCCTGACCACGACATCCACACGGACATCTGTTGGAAAAAAGTCACCAATTATGTGTGCAGCCACCCCCTGCAC
GGGCGCCGCACCACCTACACGGAGTGCTGCTGCCAGGATGGCGAGGCCTGGAGCCAGCAGTGCGCGCTGTGTCCCCCCAGGAGCTCT---GTCTACGCTC
AGCTGTGctACGTGGCCCGGATTGAAGCAGAGCGGGAGGCTGGGGTCCACTTCCGGCCGGGCTATGAGTATGGCCCCGGGCCCGAGGACCTGCACTACGG
CCTCTACGGCCCAGAGGGGGCCCCCTTCTACAACTACCTGGGCCCCGAG---------------------------------------------------
------------------------------------------------------------------------AACCAGGCTGGCTTTGAAGGGCTTCAGG
CAGAGGAGTGCGGCATCCTGAACGGCTGTGACAATGGCCGCTGCGTGCGTGTGCGGGAGGGCTACACCTGCGACTGCTTCGAGGGCTTCCAGCTGGACAC
GGCCCAGATGGCCTGT------GTGAATGAGTGTGATGACTTGAACGGGCCTGCTGCACTCTGTGTCCATGGTCACTGCGAGAACACGGAGGGCTCCTAC
CGCTGCCACTGCCCCCCAGGTTATGTGGCTGAAGCAGGTCCCCCACACTGCACTGCCAAGGAGTAG


>BGISUSP0000901101
MRPSTTRRCPGRALRNPWRSFLPLTLALFVGLGHAQRDPVGRYEPAGRDANRLRRPGGSHPAAAAAKVYGLFRDQDASVPGL------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------SVNPSLVKVHIHHPPEASVQVHQVARVRGEAEG
APEENSVETRPSPRFPTGPGHSPWSSNSIPTRSREAPRPPPPAVPRLRPLLGRCYLSAVNGQCANPLLELTAQEDCCGSVGAFWGVTSCAPCPPRP-SPV
IENGQLECPQGYKRLNLTHCE-VNECLTLGLCEDSECVNTRGSYLCTCRPGLLLDPSRSRCV-DKAVSMQQGLCYRLLGPGTCALPLAQRITKQICCCSR
VGKAWGSKCETCPLPGT-AFREICPAGHGYTYSSSDIRLSMRKAEEEELARPSWEHVQKSHGTPPGPADRQPLRAATGTWLEAGTIPDK-----------
--------------------------------------------IDRCATGATNICGPGTCVNLPDGYKCICSPGYRLHPSQAYC---------------
------------------------------IDECEQPGLCSGGRCTNTVGSYHCECDQGYIMVRKGHCQ-INECRHPGTCPDGRCVNSPGSYTCLPCEEG
YRGQSGSCV-VNECLTPGVCAHGTCLNLEGSFRCSCEPGYEVTSDEKGCQ-VDECASRASCPTGLCLNTEGSFTCSACESGYWVNEDGTACE-LDECAFP
GVCPSGVCANTAGSFSCRDCEEGYRPSALGHTC--VDECADPQSRCLGGECKNTAGSYQCLCP-------------VDECVGEEYCAPRGECLNSHGSLF
CLCAPGFASADGGTSCQ--------------------------------------------QCEDSGDSACGAWRCENSPGSHRCILGCQPGFHVAPAGD
GI-IDECANDTVCGSHGYCDNTEGSFRCLCDQCFETSASGWDC---------------------------------------------------------
-----PVPIRMECYSGQKGQPPCSSLLGRNTTQAECCC-QGTGWGDACDLCPAEDS-EFSEICPSGKGYVPVEGAWMFGQTTYT----------------
----------------------------HDECQDMACENGECVNTEGSFHCFCSPPLTLDLSQQRCVNSTS---DLPDHDIHTDICWKKVTNYVCSHPLH
GRRTTYTECCCQDGEAWSQQCALCPPRSS-VYAQLCYVARIEAEREAGVHFRPGYEYGPGPEDLHYGLYGPEGAPFYNYLGPE-----------------
------------------------NQAGFEGLQAEECGILNGCDNGRCVRVREGYTCDCFEGFQLDTAQMAC--VNECDDLNGPAALCVHGHCENTEGSY
RCHCPPGYVAEAGPPHCTAKE*