Sequences
EST Library Info
sin2Small intestine
ski1Skin
sme2M. Semimembranosus
Clusters
Oligos
SNPs

Gene ID ENSG00000080802 (click for geneview)
Transcript ID ENST00000262563(link to ensembl)
Localtion Chromosome:7:134504690:134652080:-1 band: 7q33
Description CCR4-NOT transcription complex subunit 4 (EC 6.3.2.-) (E3 ubiquitin protein ligase CNOT4) (CCR4-associated factor 4) (Potential transcriptional repressor NOT4Hp). [Source:Uniprot/SWISSPROT;Acc:O95628]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--R--S--P--D--A--K--E--D--P--V--E--C--P--L--C--M--E--P--L--E--I--D--D--I--N--F--F--P--C--T--C--
ATGTCTCGCAGTCCTGATGCGAAGGAAGACCCTGTGGAGTGCCCTCTTTGCATGGAGCCCTTGGAGATAGATGATATCAACTTTTTCCCTTGCACCTGTG
::::::::::::::::::::::::::::::::::::::.::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGTCTCGCAGTCCTGATGCGAAGGAAGACCCTGTGGAATGTCCTCTTTGCATGGAGCCCTTGGAGATAGATGATATCAACTTTTTCCCTTGCACCTGTG
-M--S--R--S--P--D--A--K--E--D--P--V--E--C--P--L--C--M--E--P--L--E--I--D--D--I--N--F--F--P--C--T--C--

-------------------------------------------------------------------------><-------------------------
G--Y--Q--I--C--R--F--C--W--H--R--I--R--T--D--E--N--G--L--C--P--A--C--R--K--P--Y--P--E--D--P--A--V--Y
GCTACCAGATTTGCCGATTTTGTTGGCATCGAATTCGCACTGATGAAAATGGGCTTTGTCCTGCATGTAGAAAGCCATATCCAGAAGACCCAGCAGTTTA
::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::
GCTACCAGATTTGCCGATTTTGTTGGCATCGAATTCGCACTGATGAAAATGGACTTTGTCCTGCATGTAGAAAGCCATATCCAGAAGACCCAGCAGTTTA
G--Y--Q--I--C--R--F--C--W--H--R--I--R--T--D--E--N--G--L--C--P--A--C--R--K--P--Y--P--E--D--P--A--V--Y

----------------------------------------------------------------------------------------------------
--K--P--L--S--Q--E--E--L--Q--R--I--K--N--E--K--K--Q--K--Q--N--E--R--K--Q--K--I--S--E--N--R--K--H--L-
TAAACCACTCTCCCAGGAAGAGCTGCAAAGGATAAAGAATGAGAAAAAACAGAAACAAAATGAGAGAAAACAGAAAATATCAGAAAATCGCAAACATTTG
:::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TAAACCACTCTCCCAGGAAGAACTGCAAAGGATAAAGAATGAGAAAAAACAGAAACAAAATGAGAGAAAACAGAAAATATCAGAAAATCGCAAACATTTG
--K--P--L--S--Q--E--E--L--Q--R--I--K--N--E--K--K--Q--K--Q--N--E--R--K--Q--K--I--S--E--N--R--K--H--L-

-----------------------------------------------------------------------><---------------------------
-A--S--V--R--V--V--Q--K--N--L--V--F--V--V--G--L--S--Q--R--L--A--D--P--E--V--L--K--R--P--E--Y--F--G--
GCTAGTGTACGTGTCGTACAAAAAAACCTCGTCTTTGTTGTAGGTTTATCTCAGCGCCTAGCAGACCCAGAGGTTTTAAAACGACCAGAATATTTTGGGA
:::::::: :::::.::::::::::::::::::::::::::::::.:.::::::::::::::::::::::::::::::::::::::::::::::::::::
GCTAGTGTTCGTGTTGTACAAAAAAACCTCGTCTTTGTTGTAGGTCTGTCTCAGCGCCTAGCAGACCCAGAGGTTTTAAAACGACCAGAATATTTTGGGA
-A--S--V--R--V--V--Q--K--N--L--V--F--V--V--G--L--S--Q--R--L--A--D--P--E--V--L--K--R--P--E--Y--F--G--

----------------------------------------------------------><----------------------------------------
K--F--G--K--I--H--K--V--V--I--N--N--S--T--S--Y--A--G--S--Q--G--P--S--A--S--A--Y--V--T--Y--I--R--S--E
AGTTTGGTAAAATACATAAAGTTGTCATCAATAATAGCACATCATATGCAGGCTCACAGGGTCCAAGTGCCAGTGCTTATGTAACCTATATCCGGTCAGA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::
AGTTTGGTAAAATACATAAAGTTGTCATCAATAATAGCACATCATATGCAGGCTCACAGGGTCCAAGCGCCAGTGCTTATGTAACCTATATCCGGTCAGA
K--F--G--K--I--H--K--V--V--I--N--N--S--T--S--Y--A--G--S--Q--G--P--S--A--S--A--Y--V--T--Y--I--R--S--E

------------------------------------------------------------><--------------------------------------
--D--A--L--R--A--I--Q--C--V--N--N--V--V--V--D--G--R--T--L--K--A--S--L--G--T--T--K--Y--C--S--Y--F--L-
AGACGCTCTCAGAGCCATACAGTGTGTCAACAATGTGGTAGTAGATGGCAGAACACTTAAGGCATCTCTAGGTACAACAAAATACTGCAGTTACTTCTTA
:::.::::::                                                   ::::: ::::::::::::::: :::::::::::::::::
AGATGCTCTC---------------------------------------------------GCATCACTAGGTACAACAAAAGACTGCAGTTACTTCTTA
--D--A--L-----------------------------------------------------A--S--L--G--T--T--K--D--C--S--Y--F--L-

--------------------------------------------------------------------------------------><------------
-K--N--M--Q--C--P--K--P--D--C--M--Y--L--H--E--L--G--D--E--A--A--S--F--T--K--E--E--M--Q--A--G--K--H--
AAGAATATGCAGTGTCCAAAACCTGACTGCATGTATCTTCATGAATTGGGGGATGAGGCGGCCAGCTTCACAAAAGAGGAAATGCAGGCGGGTAAACACC
::::::::::::::::::::.::::::::::::::.:: ::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::
AAGAATATGCAGTGTCCAAAGCCTGACTGCATGTACCTACATGAATTGGGGGACGAGGCGGCCAGCTTCACAAAAGAGGAAATGCAGGCGGGTAAACACC
-K--N--M--Q--C--P--K--P--D--C--M--Y--L--H--E--L--G--D--E--A--A--S--F--T--K--E--E--M--Q--A--G--K--H--

----------------------------------------------------------------------------------------------------
Q--E--Y--E--Q--K--L--L--Q--E--L--Y--K--L--N--P--N--F--L--Q--L--S--T--G--S--V--D--K--N--K--N--K--V--T
AAGAATATGAACAGAAGCTACTTCAAGAATTATATAAATTAAATCCCAATTTTCTTCAGCTATCTACGGGTTCAGTTGATAAAAATAAGAACAAAGTGAC
:::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::::::.:::::::::::::::::
AAGAATATGAACAGAAGCTACTTCAAGAATTATATAAATTAAACCCCAATTTTCTTCAGCTGTCTACGGGTTCAGTTGATAAGAATAAGAACAAAGTGAC
Q--E--Y--E--Q--K--L--L--Q--E--L--Y--K--L--N--P--N--F--L--Q--L--S--T--G--S--V--D--K--N--K--N--K--V--T

--------------------><--------------------------------------------------------><--------------------
--P--L--Q--R--Y--D--T--P--I--D--K--P--S--D--S--L--S--I--G--N--G--D--N--S--Q--Q--I--S--N--S--D--T--P-
ACCACTGCAGAGGTATGATACCCCCATTGACAAACCTTCAGATTCTCTCAGTATAGGGAACGGTGATAATTCCCAGCAGATATCTAACAGTGATACGCCT
:::::::::::::::::::   ::::::::::::::::: :::::::::::.::::::::.:::::::::::::::::::::::::::::::::::.:::
ACCACTGCAGAGGTATGAT---CCCATTGACAAACCTTCTGATTCTCTCAGCATAGGGAATGGTGATAATTCCCAGCAGATATCTAACAGTGATACACCT
--P--L--Q--R--Y--D-----P--I--D--K--P--S--D--S--L--S--I--G--N--G--D--N--S--Q--Q--I--S--N--S--D--T--P-

----------------------------------------------------------------------------------------------------
-S--P--P--P--G--L--S--K--S--N--P--V--I--P--I--S--S--S--N--H--S--A--R--S--P--F--E--G--A--V--T--E--S--
TCACCACCACCTGGTTTGTCAAAATCCAATCCAGTCATCCCCATCAGTTCATCCAATCACAGTGCACGGTCCCCTTTTGAAGGGGCAGTAACAGAGTCAC
:::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::: :::::::
TCACCACCACCTGGTTTATCAAAATCCAATCCAGTCATCCCCATCAGTTCATCCAATCACAGTGCACGATCTCCTTTTGAAGGGGCAGTAACTGAGTCAC
-S--P--P--P--G--L--S--K--S--N--P--V--I--P--I--S--S--S--N--H--S--A--R--S--P--F--E--G--A--V--T--E--S--

----------------------------------------------------------------------------------------------------
Q--S--L--F--S--D--N--F--R--H--P--N--P--I--P--S--G--L--P--P--F--P--S--S--P--Q--T--S--S--D--W--P--T--A
AGTCGTTATTCTCAGACAATTTTCGCCATCCCAACCCTATCCCAAGTGGGCTTCCTCCTTTCCCCAGCTCCCCACAGACATCCAGTGACTGGCCTACAGC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGTCGTTATTCTCAGACAATTTTCGCCATCCCAACCCTATCCCAAGTGGGCTTCCTCCTTTCCCCAGCTCCCCACAGACATCCAGTGACTGGCCTACAGC
Q--S--L--F--S--D--N--F--R--H--P--N--P--I--P--S--G--L--P--P--F--P--S--S--P--Q--T--S--S--D--W--P--T--A

----------------------------><----------------------------------------------------------------------
--P--E--P--Q--S--L--F--T--S--E--T--I--P--V--S--S--S--T--D--W--Q--A--A--F--G--F--G--S--S--K--Q--P--E-
ACCAGAACCACAGAGCCTCTTCACATCAGAAACAATCCCAGTATCATCCTCTACAGACTGGCAAGCAGCTTTTGGCTTTGGTTCTTCTAAACAACCAGAG
::::::.:::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::
ACCAGAGCCACAGAGCCTCTTCACATCA---ACAATCCCAGTATCATCCTCTACAGACTGGCAAGCAGCATTTGGCTTTGGTTCTTCTAAACAACCAGAG
--P--E--P--Q--S--L--F--T--S-----T--I--P--V--S--S--S--T--D--W--Q--A--A--F--G--F--G--S--S--K--Q--P--E-

----------------------------------------------------------------------------------------------------
-D--D--L--G--F--D--P--F--D--V--T--R--K--A--L--A--D--L--I--E--K--E--L--S--V--Q--D--Q--P--S--L--S--P--
GATGACTTGGGTTTTGATCCCTTCGATGTCACTCGAAAAGCCTTAGCAGACCTGATTGAGAAGGAACTGTCCGTTCAAGACCAACCTTCCCTTTCGCCCA
::::::::.::::::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::: ::.::::::::.::::::::::::::::
GATGACTTAGGTTTTGATCCCTTTGATGTCACTCGAAAAGCCTTAGCAGACCTGATTGAAAAGGAACTGTCAGTCCAAGACCAGCCTTCCCTTTCGCCCA
-D--D--L--G--F--D--P--F--D--V--T--R--K--A--L--A--D--L--I--E--K--E--L--S--V--Q--D--Q--P--S--L--S--P--

----------------------------------------------------------------------------------------------------
T--S--L--Q--N--S--S--S--H--T--T--T--A--K--G--P--G--S--G--F--L--H--P--A--A--A--T--N--A--N--S--L--N--S
CATCTCTTCAGAACTCCTCTTCACACACTACAACCGCCAAAGGTCCAGGCTCTGGATTCCTGCATCCTGCTGCAGCTACAAATGCCAATTCTCTCAATAG
:::::::::::::. ::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::: :::::::::::::.:::::::::::
CATCTCTTCAGAATGCCTCTTCACACACTACAACCGCCAAAGGCCCAGGCTCTGGATTCCTGCATCCTGCTGCACCTACAAATGCCAACTCTCTCAATAG
T--S--L--Q--N--A--S--S--H--T--T--T--A--K--G--P--G--S--G--F--L--H--P--A--A--P--T--N--A--N--S--L--N--S

----------------------------------------------------------------------------------------------------
--T--F--S--V--L--P--Q--R--F--P--Q--F--Q--Q--H--R--A--V--Y--N--S--F--S--F--P--G--Q--A--A--R--Y--P--W-
TACCTTTTCAGTCTTGCCCCAGAGGTTCCCTCAATTTCAGCAGCACCGAGCGGTTTATAATTCATTCAGTTTTCCAGGCCAGGCAGCCCGCTATCCTTGG
:::::::::::::::::: ::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::
TACCTTTTCAGTCTTGCCACAGAGGTTCCCTCAATTTCAGCAGCACCGAGCAGTTTATAATTCATTCAGTTTTCCAGGCCAGGCAGCCCGCTATCCTTGG
--T--F--S--V--L--P--Q--R--F--P--Q--F--Q--Q--H--R--A--V--Y--N--S--F--S--F--P--G--Q--A--A--R--Y--P--W-

----------------------------------------------------------------------------------------------------
-M--A--F--P--R--N--S--I--M--H--L--N--H--T--A--N--P--T--S--N--S--N--F--L--D--L--N--L--P--P--Q--H--N--
ATGGCCTTTCCACGCAATAGCATCATGCACTTGAACCACACAGCAAACCCCACCTCAAATAGTAATTTCTTGGACTTGAATCTCCCGCCACAGCACAACA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGGCCTTTCCACGCAATAGCATCATGCACTTGAACCACACAGCAAACCCCACCTCAAATAGTAATTTCTTGGACTTGAATCTCCCGCCACAGCACAACA
-M--A--F--P--R--N--S--I--M--H--L--N--H--T--A--N--P--T--S--N--S--N--F--L--D--L--N--L--P--P--Q--H--N--

--------------------------><------------------------------------------------------------------------
T--G--L--G--G--I--P--V--A--D--N--S--S--S--V--E--S--L--N--M--K--E--W--Q--D--G--L--R--A--L--L--P--N--I
CAGGTCTGGGAGGGATCCCTGTAGCAGACAACAGCAGTTCTGTAGAGAGTTTAAATATGAAGGAATGGCAGGACGGGCTAAGGGCACTTCTACCCAACAT
::::::::::::::::::::.:::::   :::::::::::::::::::::::::.:::::::::.:::::::::::::::::::::::::::::::::::
CAGGTCTGGGAGGGATCCCTATAGCA---AACAGCAGTTCTGTAGAGAGTTTAAGTATGAAGGAGTGGCAGGACGGGCTAAGGGCACTTCTACCCAACAT
T--G--L--G--G--I--P--I--A-----N--S--S--S--V--E--S--L--S--M--K--E--W--Q--D--G--L--R--A--L--L--P--N--I

----------------------------------------------------------------------------------------------------
--N--I--N--F--G--G--L--P--N--S--S--S--P--S--N--A--N--H--S--A--P--T--S--N--T--A--T--T--D--S--L--S--W-
TAACATCAACTTTGGTGGACTGCCCAATTCTTCTTCCCCCTCCAACGCCAACCACAGTGCACCAACGTCCAACACTGCCACCACCGACAGCCTGAGTTGG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TAACATCAACTTTGGTGGACTGCCCAATTCTTCTTCCCCCTCCAACGCCAACCACAGTGCACCAACGTCCAACACTGCCACCACCGACAGCCTGAGTTGG
--N--I--N--F--G--G--L--P--N--S--S--S--P--S--N--A--N--H--S--A--P--T--S--N--T--A--T--T--D--S--L--S--W-

---------------------------------------><-----------------------------------------------------------
-D--S--P--G--S--W--T--D--P--A--I--I--T--G--I--P--A--S--S--G--N--S--L--D--S--L--Q--D--D--N--P--P--H--
GACAGCCCTGGCAGCTGGACAGACCCAGCCATCATCACAGGTATTCCAGCGTCTTCAGGAAACAGTTTAGACTCTCTTCAAGATGACAATCCTCCACACT
                                          .:::::::.:::::::::::::::::::::::::::::::::::::::::::::::::
------------------------------------------GTTCCAGCATCTTCAGGAAACAGTTTAGACTCTCTTCAAGATGACAATCCTCCACACT
-------------------------------------------V--P--A--S--S--G--N--S--L--D--S--L--Q--D--D--N--P--P--H--

----------------------------------------------------------------------------------------------------
W--L--K--S--L--Q--A--L--T--E--M--D--G--P--S--A--A--P--S--Q--T--H--H--S--A--P--F--S--T--Q--I--P--L--H
GGCTAAAATCCCTTCAGGCCCTCACAGAGATGGACGGCCCCAGCGCTGCTCCATCACAGACCCACCACAGCGCCCCCTTCAGCACACAGATCCCGCTGCA
:::::::::::::::::::::::::::::::::::::::::::.:::::::: :::::.::::::::::::::::::::::::::::::::::: :::::
GGCTAAAATCCCTTCAGGCCCTCACAGAGATGGACGGCCCCAGTGCTGCTCCCTCACAAACCCACCACAGCGCCCCCTTCAGCACACAGATCCCTCTGCA
W--L--K--S--L--Q--A--L--T--E--M--D--G--P--S--A--A--P--S--Q--T--H--H--S--A--P--F--S--T--Q--I--P--L--H

---------------------------------------------------------><-----------------------------------------
--R--A--S--W--N--P--Y--P--P--P--S--N--P--S--S--F--H--S--P--A--F--R--Q--P--S--D--P--P--A--K--P--P--Q-
CAGAGCCAGTTGGAATCCCTACCCTCCTCCTTCAAACCCTTCCAGCTTCCACTCCCCAGCTTTCAGACAGCCTTCAGACCCCCCAGCAAAACCCCCACAG
:::::::::::::::.:::::::: :::::::::::.::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::
CAGAGCCAGTTGGAACCCCTACCCACCTCCTTCAAATCCTTCCAGCTTCCACTCC---GCTTTCAGACAGCCTTCAGACCCCCCAGCAAAACCCCCACAG
--R--A--S--W--N--P--Y--P--P--P--S--N--P--S--S--F--H--S-----A--F--R--Q--P--S--D--P--P--A--K--P--P--Q-

----------------------------------------------------------------------------------------------------
-I--Y--Y--R--V--Q--H--W--T--A--I--R--Q--R--G--A--T--I--R--K--C--R--I--C--P--T--L--F--S--P--S--Q--P--
ATTTACTACAGAGTTCAACACTGGACCGCCATTAGGCAAAGAGGAGCAACCATTAGAAAATGCAGGATTTGTCCCACTCTGTTTTCTCCCTCTCAGCCCA
:::::::::::::::::::::::::::::::::::: ::.:::::: : .::: :::::::::::::::::::::::.::::::::::::::::::::: 
ATTTACTACAGAGTTCAACACTGGACCGCCATTAGGGAAGGAGGAGAATTCATGAGAAAATGCAGGATTTGTCCCACCCTGTTTTCTCCCTCTCAGCCC-
-I--Y--Y--R--V--Q--H--W--T--A--I--R--E--G--G--E--F--M--R--K--C--R--I--C--P--T--L--F--S--P--S--Q--P--

----------------------------------------------------------------------------------------------------
T--T--H--S--S--L--L--I--S--Y--V--L--K--N--P--V--P--D--Q--F--F--F--S--L--T--P--D--A--M--R--S--Q--G--H
CCACCCACAGCTCCCTTCTCATCTCTTATGTTCTGAAGAATCCAGTACCTGATCAATTTTTTTTCTCCCTAACCCCAGATGCAATGCGATCACAGGGTCA
  ::::::::::::::::::                                                                                
--ACCCACAGCTCCCTTCTC--------------------------------------------------------------------------------
---T--H--S--S--L--L---------------------------------------------------------------------------------

------------------------------------>
--Y--H--L--F--I--N--C--K--N--F--C--*-
TTACCATCTCTTTATTAATTGTAAAAATTTTTGTTGA
                                     
-------------------------------------
-------------------------------------

Pig Consensus Sequence

>BGISUST0000888828
ATGTCTCGCAGTCCTGATGCGAAGGAAGACCCTGTGGAATGTCCTCTTTGCATGGAGCCCTTGGAGATAGATGATATCAACTTTTTCCCTTGCACCTGTG
GCTACCAGATTTGCCGATTTTGTTGGCATCGAATTCGCACTGATGAAAATGGACTTTGTCCTGCATGTAGAAAGCCATATCCAGAAGACCCAGCAGTTTA
TAAACCACTCTCCCAGGAAGAACTGCAAAGGATAAAGAATGAGAAAAAACAGAAACAAAATGAGAGAAAACAGAAAATATCAGAAAATCGCAAACATTTG
GCTAGTGTTCGTGTTGTACAAAAAAACCTCGTCTTTGTTGTAGGTCTGTCTCAGCGCCTAGCAGACCCAGAGGTTTTAAAACGACCAGAATATTTTGGGA
AGTTTGGTAAAATACATAAAGTTGTCATCAATAATAGCACATCATATGCAGGCTCACAGGGTCCAAGCGCCAGTGCTTATGTAACCTATATCCGGTCAGA
AGATGCTCTC---------------------------------------------------GCATCACTAGGTACAACAAAAGACTGCAGTTACTTCTTA
AAGAATATGCAGTGTCCAAAGCCTGACTGCATGTACCTACATGAATTGGGGGACGAGGCGGCCAGCTTCACAAAAGAGGAAATGCAGGCGGGTAAACACC
AAGAATATGAACAGAAGCTACTTCAAGAATTATATAAATTAAACCCCAATTTTCTTCAGCTGTCTACGGGTTCAGTTGATAAGAATAAGAACAAAGTGAC
ACCACTGCAGAGGTATGAT---CCCATTGACAAACCTTCTGATTCTCTCAGCATAGGGAATGGTGATAATTCCCAGCAGATATCTAACAGTGATACACCT
TCACCACCACCTGGTTTATCAAAATCCAATCCAGTCATCCCCATCAGTTCATCCAATCACAGTGCACGATCTCCTTTTGAAGGGGCAGTAACTGAGTCAC
AGTCGTTATTCTCAGACAATTTTCGCCATCCCAACCCTATCCCAAGTGGGCTTCCTCCTTTCCCCAGCTCCCCACAGACATCCAGTGACTGGCCTACAGC
ACCAGAGCCACAGAGCCTCTTCACATCA---ACAATCCCAGTATCATCCTCTACAGACTGGCAAGCAGCATTTGGCTTTGGTTCTTCTAAACAACCAGAG
GATGACTTAGGTTTTGATCCCTTTGATGTCACTCGAAAAGCCTTAGCAGACCTGATTGAAAAGGAACTGTCAGTCCAAGACCAGCCTTCCCTTTCGCCCA
CATCTCTTCAGAATGCCTCTTCACACACTACAACCGCCAAAGGCCCAGGCTCTGGATTCCTGCATCCTGCTGCACCTACAAATGCCAACTCTCTCAATAG
TACCTTTTCAGTCTTGCCACAGAGGTTCCCTCAATTTCAGCAGCACCGAGCAGTTTATAATTCATTCAGTTTTCCAGGCCAGGCAGCCCGCTATCCTTGG
ATGGCCTTTCCACGCAATAGCATCATGCACTTGAACCACACAGCAAACCCCACCTCAAATAGTAATTTCTTGGACTTGAATCTCCCGCCACAGCACAACA
CAGGTCTGGGAGGGATCCCTATAGCA---AACAGCAGTTCTGTAGAGAGTTTAAGTATGAAGGAGTGGCAGGACGGGCTAAGGGCACTTCTACCCAACAT
TAACATCAACTTTGGTGGACTGCCCAATTCTTCTTCCCCCTCCAACGCCAACCACAGTGCACCAACGTCCAACACTGCCACCACCGACAGCCTGAGTTGG
------------------------------------------GTTCCAGCATCTTCAGGAAACAGTTTAGACTCTCTTCAAGATGACAATCCTCCACACT
GGCTAAAATCCCTTCAGGCCCTCACAGAGATGGACGGCCCCAGTGCTGCTCCCTCACAAACCCACCACAGCGCCCCCTTCAGCACACAGATCCCTCTGCA
CAGAGCCAGTTGGAACCCCTACCCACCTCCTTCAAATCCTTCCAGCTTCCACTCC---GCTTTCAGACAGCCTTCAGACCCCCCAGCAAAACCCCCACAG
ATTTACTACAGAGTTCAACACTGGACCGCCATTAGGGAAGGAGGAGAATTCATGAGAAAATGCAGGATTTGTCCCACCCTGTTTTCTCCCTCTCAGCCCA
CCCACAGCTCCCTTCTC-----------------------------------------------------------------------------------
----------------------------------


>BGISUSP0000888828
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHL
ASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDAL-----------------ASLGTTKDCSYFL
KNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYD-PIDKPSDSLSIGNGDNSQQISNSDTP
SPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTS-TIPVSSSTDWQAAFGFGSSKQPE
DDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNASSHTTTAKGPGSGFLHPAAPTNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPW
MAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPIA-NSSSVESLSMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTATTDSLSW
--------------VPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHS-AFRQPSDPPAKPPQ
IYYRVQHWTAIREGGEFMRKCRICPTLFSPSQPTHSSLL---------------------------------------