Sequences
EST Library Info
nep2Newborn 115 days, epidermis
Clusters
Oligos
SNPs

Gene ID ENSG00000107560 (click for geneview)
Transcript ID ENST00000263144(link to ensembl)
Symbol RAB11FIP2
Localtion Chromosome:10:119754419:119796104:-1 band: 10q26.11
Description Rab11 family-interacting protein 2 (Rab11-FIP2) (NRip11). [Source:Uniprot/SWISSPROT;Acc:Q7L804]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--M--L--S--E--Q--A--Q--K--W--F--P--T--H--V--Q--V--T--V--L--Q--A--K--D--L--K--P--K--G--K--S--G--T--
ATGATGCTGTCCGAGCAAGCCCAAAAGTGGTTTCCAACCCACGTGCAGGTCACAGTGCTCCAAGCCAAAGATCTGAAGCCAAAAGGCAAAAGTGGTACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--D--T--Y--T--I--I--Q--L--G--K--E--K--Y--S--T--S--V--A--E--K--T--L--E--P--V--W--K--E--E--A--S--F--E
ATGACACATACACTATAATTCAGCTGGGCAAGGAAAAGTACTCCACCTCTGTAGCTGAGAAAACCCTTGAGCCAGTTTGGAAGGAGGAGGCCTCTTTCGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--P--G--L--L--I--Q--G--S--P--E--K--Y--I--L--F--L--I--V--M--H--R--S--L--V--G--L--D--K--F--L--G--Q-
GCTACCTGGATTGCTAATTCAGGGAAGTCCAGAGAAATACATTCTTTTCCTTATAGTTATGCACAGGTCCCTGGTGGGTCTGGATAAATTTTTAGGGCAG
                      ::.:.:::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.::::::::::::
----------------------GGGAATCCAGAGAAATACATCCTTTTCCTTATAGTTATGCACAGGTCCCTGGTGGGTCTGGATAAGTTTTTAGGGCAG
-----------------------G--N--P--E--K--Y--I--L--F--L--I--V--M--H--R--S--L--V--G--L--D--K--F--L--G--Q-

----------------------------------------------------><----------------------------------------------
-V--A--I--N--L--N--D--I--F--E--D--K--Q--R--R--K--T--E--W--F--R--L--E--S--K--Q--G--K--R--I--K--N--R--
GTGGCAATCAATCTCAATGACATCTTTGAGGACAAACAAAGAAGGAAAACAGAGTGGTTTAGATTAGAATCCAAACAAGGAAAACGAATCAAAAACAGGG
::::: :::::::::::::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::: ::..:::::::::::
GTGGCCATCAATCTCAATGACATCTTTGAGGACAAACAAAGAAGGAAAACA---TGGTTTAGATTAGAATCCAAACAAGGAAAAAGAGCCAAAAACAGGG
-V--A--I--N--L--N--D--I--F--E--D--K--Q--R--R--K--T-----W--F--R--L--E--S--K--Q--G--K--R--A--K--N--R--

----------------------------------------------------------------------------------------------------
G--E--I--K--V--N--I--Q--F--M--R--N--N--M--T--A--S--M--F--D--L--S--M--K--D--K--T--R--S--P--F--A--K--L
GTGAGATAAAGGTCAATATTCAGTTTATGAGGAACAATATGACCGCAAGTATGTTTGACTTATCAATGAAGGACAAAACCAGATCTCCTTTTGCAAAGTT
::::::::::::::::::::::.:::::::::::::::::::: ::::::::::::::::::::::::::::::::::: :::::::::::::::::.::
GTGAGATAAAGGTCAATATTCAATTTATGAGGAACAATATGACAGCAAGTATGTTTGACTTATCAATGAAGGACAAAACAAGATCTCCTTTTGCAAAATT
G--E--I--K--V--N--I--Q--F--M--R--N--N--M--T--A--S--M--F--D--L--S--M--K--D--K--T--R--S--P--F--A--K--L

----------------------------------------------------------------------------------------------------
--K--D--K--M--K--G--R--K--N--D--G--T--F--S--D--T--S--S--A--I--I--P--S--T--H--M--P--D--A--N--S--E--F-
AAAAGATAAGATGAAGGGTAGAAAAAATGATGGAACATTTTCTGATACGTCTTCTGCAATCATTCCAAGTACTCACATGCCCGATGCCAATAGTGAATTT
:::::::::::::::.:::::::::::::::::.::::::::::::::.::::::::::::::::::::: ::::::::::.:::::::::: :::::::
AAAAGATAAGATGAAAGGTAGAAAAAATGATGGGACATTTTCTGATACATCTTCTGCAATCATTCCAAGTTCTCACATGCCTGATGCCAATACTGAATTT
--K--D--K--M--K--G--R--K--N--D--G--T--F--S--D--T--S--S--A--I--I--P--S--S--H--M--P--D--A--N--T--E--F-

----------------------------------------------------------------------------------------------------
-S--S--G--E--I--Q--M--K--S--K--P--K--K--P--F--L--L--G--P--Q--R--L--S--S--A--H--S--M--S--D--L--S--G--
TCAAGTGGTGAAATACAGATGAAATCCAAACCAAAAAAGCCTTTTCTCTTGGGTCCTCAGCGACTCTCGTCAGCGCATTCAATGTCTGATTTATCTGGGT
::::::.:::::::::::::::::::.:::::::::::::::::.::.:::::::::::::::::::: ::.::::::::::::::::::::: ::::: 
TCAAGTAGTGAAATACAGATGAAATCTAAACCAAAAAAGCCTTTCCTTTTGGGTCCTCAGCGACTCTCTTCGGCGCATTCAATGTCTGATTTAACTGGGG
-S--S--S--E--I--Q--M--K--S--K--P--K--K--P--F--L--L--G--P--Q--R--L--S--S--A--H--S--M--S--D--L--T--G--

-----------------------------------------------------------------------------------------------><---
S--H--M--S--S--E--K--L--K--A--G--T--I--G--Q--T--H--L--L--G--H--Q--L--D--S--F--G--T--V--P--E--S--G--S
CCCATATGTCTTCTGAGAAACTGAAGGCTGGCACCATAGGTCAAACACATCTTCTCGGACACCAGTTAGATTCCTTTGGAACAGTTCCAGAAAGTGGAAG
::::.:: ::::: :::::.:::::: : :::.:::: : :::::: :::::::::::::.:::: :::: .::::::::.:::::::.::::::   ::
CCCACATTTCTTCGGAGAAGCTGAAGTCGGGCGCCATCGCTCAAACTCATCTTCTCGGACGCCAGATAGAGCCCTTTGGAGCAGTTCCGGAAAGT---AG
A--H--I--S--S--E--K--L--K--S--G--A--I--A--Q--T--H--L--L--G--R--Q--I--E--P--F--G--A--V--P--E--S-----S

----------------------------------------------------------------------------------------------------
--L--K--S--P--H--R--R--T--L--S--F--D--T--S--K--M--N--Q--P--D--S--I--V--D--E--G--E--L--C--F--G--R--Q-
TCTCAAATCTCCACACAGAAGAACATTAAGCTTTGATACTTCTAAAATGAACCAACCTGACAGCATTGTGGATGAAGGTGAATTGTGTTTCGGAAGACAA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::: ::::::::::.:: :::::::::::::
TCTCAAATCTCCACACAGAAGAACATTAAGCTTTGATACTTCTAAAATGAACCAACCTGACAGCAATGTGGAAGAAGGTGAATCGTCTTTCGGAAGACAA
--L--K--S--P--H--R--R--T--L--S--F--D--T--S--K--M--N--Q--P--D--S--N--V--E--E--G--E--S--S--F--G--R--Q-

----------------------------------------------------------------------------------------------------
-N--D--P--F--T--N--V--T--A--S--L--P--Q--K--F--A--T--L--P--R--K--K--N--P--F--E--E--S--S--E--T--W--D--
AATGACCCATTTACAAATGTGACTGCTTCATTACCCCAAAAATTTGCAACACTGCCAAGGAAGAAAAATCCATTTGAAGAAAGCAGCGAAACATGGGACA
:.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::: : :::::::
AGTGACCCATTTACAAATGTGACTGCTTCATTACCCCAAAAATTTGCAACACTGCCAAGGAAGAAAAATCCATTTGAAGAAAGCAGTGAATCCTGGGACA
-S--D--P--F--T--N--V--T--A--S--L--P--Q--K--F--A--T--L--P--R--K--K--N--P--F--E--E--S--S--E--S--W--D--

----------------------------------------------------------------------------------------------------
S--S--M--N--L--F--S--K--P--I--E--I--R--K--E--N--K--R--E--K--R--E--K--V--S--L--F--E--R--V--T--G--K--K
GCAGCATGAATTTATTTTCAAAACCAATTGAAATAAGAAAAGAAAATAAAAGAGAGAAAAGGGAGAAAGTTAGCCTGTTTGAAAGAGTGACTGGAAAAAA
:::::.:::::::::::::::::.:..:::::.::::::::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::
GCAGCGTGAATTTATTTTCAAAATCGGTTGAAGTAAGAAAAGAAAATAAGAGAGAGAAAAGAGAGAAAGTTAGCCTGTTTGAAAGAGTGACTGGAAAAAA
S--S--V--N--L--F--S--K--S--V--E--V--R--K--E--N--K--R--E--K--R--E--K--V--S--L--F--E--R--V--T--G--K--K

----------------------------------------------------------------------------------------------------
--D--S--R--R--S--D--K--L--N--N-----G--G--S--D--S--P--C--D--L--K--S--P--N--A--F--S--E--N--R--Q--D--Y-
AGATAGCAGAAGATCTGATAAACTTAACAAT---GGGGGATCTGATAGCCCTTGTGACTTGAAATCACCTAATGCATTTAGTGAAAATCGCCAGGACTAT
::::::::::::.:::::::::::::::..    ::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::::::
AGATAGCAGAAGGTCTGATAAACTTAACGGGT--GGGGGATCCGATAGCCCTTGTGACTTGAAATCACCTAATGCATTTAGTGAAAATCGTCAGGACTAT
--D--S--R--R--S--D--K--L--N--G--\--G--G--S--D--S--P--C--D--L--K--S--P--N--A--F--S--E--N--R--Q--D--Y-

-------------------------------------------------------------------><-------------------------------
-F--D--Y--E--S--T--N--P--F--T--A--K--F--R--A--S--N--I--M--P--S--S--S--F--H--M--S--P--T--S--N--E--D--
TTTGATTATGAGTCAACCAATCCATTTACAGCAAAATTCAGGGCTTCAAATATAATGCCATCTTCAAGTTTTCATATGAGTCCAACAAGCAATGAAGACC
:::::::::::::::::.:::::.::::::.:::::::::::::::::::::::::::::::::::                                  
TTTGATTATGAGTCAACTAATCCGTTTACAACAAAATTCAGGGCTTCAAATATAATGCCATCTTCA----------------------------------
-F--D--Y--E--S--T--N--P--F--T--T--K--F--R--A--S--N--I--M--P--S--S-----------------------------------

-------------><-------------------------------------------------------------------------------------
L--R--K--I--P--D--S--N--P--F--D--A--T--A--G--Y--R--S--L--T--Y--E--E--V--L--Q--E--L--V--K--H--K--E--L
TCAGGAAAATCCCGGACAGCAACCCCTTTGATGCCACTGCAGGGTATCGTAGTCTGACCTATGAAGAGGTTCTACAGGAGCTGGTGAAACACAAAGAACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--R--R--K--D--T--H--I--R--E--L--E--D--Y--I--D--N--L--L--V--R--V--M--E--E--T--P--S--I--L--R--V--P-
CCTTAGGAGGAAAGACACCCACATCCGGGAACTCGAGGACTACATCGACAACCTCCTTGTAAGGGTAATGGAAGAAACGCCCAGTATTCTCAGAGTGCCG
    ::::::::.:::::::::::::::::.:: :::::::::::::::::::::::.:::::::: :::::::::::::::::.::::::::::::::.
----AGGAGGAAGGACACCCACATCCGGGAGCTGGAGGACTACATCGACAACCTCCTCGTAAGGGTCATGGAAGAAACGCCCAGCATTCTCAGAGTGCCA
-----R--R--K--D--T--H--I--R--E--L--E--D--Y--I--D--N--L--L--V--R--V--M--E--E--T--P--S--I--L--R--V--P-

----------------------------------------->
-Y--E--P--S--R--K--A--G--K--F--S--N--S--*-
TATGAACCATCCAGGAAAGCTGGCAAATTCTCTAACAGTTAA
::.::.::.::::::::.:::::::::::: :.::.::.:.:
TACGAGCCGTCCAGGAAGGCTGGCAAATTCGCCAATAGCTGA
-Y--E--P--S--R--K--A--G--K--F--A--N--S--*-

Pig Consensus Sequence

>BGISUST0000898850
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------GGGAATCCAGAGAAATACATCCTTTTCCTTATAGTTATGCACAGGTCCCTGGTGGGTCTGGATAAGTTTTTAGGGCAG
GTGGCCATCAATCTCAATGACATCTTTGAGGACAAACAAAGAAGGAAAACA---TGGTTTAGATTAGAATCCAAACAAGGAAAAAGAGCCAAAAACAGGG
GTGAGATAAAGGTCAATATTCAATTTATGAGGAACAATATGACAGCAAGTATGTTTGACTTATCAATGAAGGACAAAACAAGATCTCCTTTTGCAAAATT
AAAAGATAAGATGAAAGGTAGAAAAAATGATGGGACATTTTCTGATACATCTTCTGCAATCATTCCAAGTTCTCACATGCCTGATGCCAATACTGAATTT
TCAAGTAGTGAAATACAGATGAAATCTAAACCAAAAAAGCCTTTCCTTTTGGGTCCTCAGCGACTCTCTTCGGCGCATTCAATGTCTGATTTAACTGGGG
CCCACATTTCTTCGGAGAAGCTGAAGTCGGGCGCCATCGCTCAAACTCATCTTCTCGGACGCCAGATAGAGCCCTTTGGAGCAGTTCCGGAAAGT---AG
TCTCAAATCTCCACACAGAAGAACATTAAGCTTTGATACTTCTAAAATGAACCAACCTGACAGCAATGTGGAAGAAGGTGAATCGTCTTTCGGAAGACAA
AGTGACCCATTTACAAATGTGACTGCTTCATTACCCCAAAAATTTGCAACACTGCCAAGGAAGAAAAATCCATTTGAAGAAAGCAGTGAATCCTGGGACA
GCAGCGTGAATTTATTTTCAAAATCGGTTGAAGTAAGAAAAGAAAATAAGAGAGAGAAAAGAGAGAAAGTTAGCCTGTTTGAAAGAGTGACTGGAAAAAA
AGATAGCAGAAGGTCTGATAAACTTAACGGggGGGGATCCGATAGCCCTTGTGACTTGAAATCACCTAATGCATTTAGTGAAAATCGTCAGGACTATTTT
GATTATGAGTCAACTAATCCGTTTACAACAAAATTCAGGGCTTCAAATATAATGCCATCTTCA-------------------------------------
----------------------------------------------------------------------------------------------------
-AGGAGGAAGGACACCCACATCCGGGAGCTGGAGGACTACATCGACAACCTCCTCGTAAGGGTCATGGAAGAAACGCCCAGCATTCTCAGAGTGCCATAC
GAGCCGTCCAGGAAGGCTGGCAAATTCGCCAATAGCTGA


>BGISUSP0000898850
--------------------------------------------------------------------------GNPEKYILFLIVMHRSLVGLDKFLGQ
VAINLNDIFEDKQRRKT-WFRLESKQGKRAKNRGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTFSDTSSAIIPSSHMPDANTEF
SSSEIQMKSKPKKPFLLGPQRLSSAHSMSDLTGAHISSEKLKSGAIAQTHLLGRQIEPFGAVPES-SLKSPHRRTLSFDTSKMNQPDSNVEEGESSFGRQ
SDPFTNVTASLPQKFATLPRKKNPFEESSESWDSSVNLFSKSVEVRKENKREKREKVSLFERVTGKKDSRRSDKLNGGGSDSPCDLKSPNAFSENRQDYF
DYESTNPFTTKFRASNIMPSS----------------------------------------------RRKDTHIRELEDYIDNLLVRVMEETPSILRVPY
EPSRKAGKFANS*