Sequences
EST Library Info
cmu2Rhinal mucous membrane - RNA from China
ecc1Foetus 50 days, cortex cerebri
ese1Foetus 50 days, M. semitendinosus
jej1Small intestine, jejunum
nlu1Newborn 115 days, lung
ova7Ovary
pgl1Pituitary gland
plac1Unavailable
plun1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000115963 (click for geneview)
Transcript ID ENST00000263895(link to ensembl)
Symbol RND3
Localtion Chromosome:2:151150220:151169672:-1 band: 2q23.3
Description Rho-related GTP-binding protein RhoE (Rho family GTPase 3) (Rnd3) (Rho8) (MemB protein).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--E--R--R--A--S--Q--K--L--S--S--K-----S--I--M--D--P--N--Q--N--V--K--C--K--I--V--V-----V--G--D--
ATGAAGGAGAGAAGAGCCAGCCAGAAATTATCCAGCAAA---TCTATCATGGATCCTAATCAGAACGTGAAATGCAAGATAGTTGTG---GTGGGAGACA
:::::::::::::::::::::::::::::::::::.:::   ::::::::::::::::::::::::::::::::::::::::: :::   ::::::::.:
ATGAAGGAGAGAAGAGCCAGCCAGAAATTATCCAGTAAAA--TCTATCATGGATCCTAATCAGAACGTGAAATGCAAGATAGTAGTGG--GTGGGAGATA
-M--K--E--R--R--A--S--Q--K--L--S--S--K--\--S--I--M--D--P--N--Q--N--V--K--C--K--I--V--V--\--V--G--D--

----------------------------------------------------------><----------------------------------------
S--Q--C--G--K--T--A-----L--L--H--V--F--A--K--D--C--F--P--E--N--Y--V--P--T--V--F--E--N--Y--T--A--S--F
GTCAGTGTGGAAAAACTGCG---CTGCTCCATGTCTTCGCCAAGGACTGCTTCCCCGAGAATTACGTTCCTACAGTGTTTGAGAATTACACGGCCAGTTT
::::::::::.:::::.:::   ::::: ::.:::::::::::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::
GTCAGTGTGGGAAAACCGCGC--CTGCTGCACGTCTTCGCCAAAGACTGCTTCCCCGAGAATTACGTCCCTACAGTGTTTGAGAATTACACGGCCAGTTT
S--Q--C--G--K--T--A--\--L--L--H--V--F--A--K--D--C--F--P--E--N--Y--V--P--T--V--F--E--N--Y--T--A--S--F

----------------------------------------------><----------------------------------------------------
--E--I--D--T--Q--R--I--E--L--S--L--W--D--T--S--G--S--P--Y--Y--D--N--V--R--P--L--S--Y--P--D--S--D--A-
TGAAATCGACACACAAAGAATAGAGTTGAGCCTGTGGGACACTTCGGGTTCTCCTTACTATGACAATGTCCGCCCCCTCTCTTACCCTGATTCGGATGCT
.:::::::::::::::::::::::.:::::::::::::::::::::   :::::::::::::::::.::::: ::::::::.::::: ::.::.::.::.
CGAAATCGACACACAAAGAATAGAATTGAGCCTGTGGGACACTTCG---TCTCCTTACTATGACAACGTCCGGCCCCTCTCCTACCCAGACTCAGACGCC
--E--I--D--T--Q--R--I--E--L--S--L--W--D--T--S-----S--P--Y--Y--D--N--V--R--P--L--S--Y--P--D--S--D--A-

--------------------------------------------------------><------------------------------------------
-V--L--I--C--F--D--I--S--R--P--E--T--L--D--S--V--L--K--K--W--K--G--E--I--Q--E--F--C--P--N--T--K--M--
GTGCTGATTTGCTTTGACATCAGTAGACCAGAGACCCTGGACAGTGTCCTCAAAAAGTGGAAAGGTGAAATCCAGGAATTTTGTCCAAATACCAAAATGC
:::::::::::::::::::::::::::::::::::.:::::::::::::: ::::::::::::::::::::::::::.:::::::: ::.::::::::::
GTGCTGATTTGCTTTGACATCAGTAGACCAGAGACTCTGGACAGTGTCCTGAAAAAGTGGAAAGGTGAAATCCAGGAGTTTTGTCCCAACACCAAAATGC
-V--L--I--C--F--D--I--S--R--P--E--T--L--D--S--V--L--K--K--W--K--G--E--I--Q--E--F--C--P--N--T--K--M--

-------------------------------------------------------------------------------------------><-------
L--L--V--G--C--K--S--D--L--R--T--D--V--S--T--L--V--E--L--S--N--H--R--Q--T--P--V--S--Y--D--Q--G--A--N
TCTTGGTCGGCTGCAAGTCTGATCTGCGGACAGATGTTAGTACATTAGTAGAGCTCTCCAATCACAGGCAGACGCCAGTGTCCTATGACCAGGGGGCAAA
::::::::::::::::.:::::::: :::::::::::.:::::::::::::::::::: ::.:::::::::::.:::::::::::.::::::::::::::
TCTTGGTCGGCTGCAAATCTGATCTTCGGACAGATGTCAGTACATTAGTAGAGCTCTCAAACCACAGGCAGACACCAGTGTCCTACGACCAGGGGGCAAA
L--L--V--G--C--K--S--D--L--R--T--D--V--S--T--L--V--E--L--S--N--H--R--Q--T--P--V--S--Y--D--Q--G--A--N

----------------------------------------------------------------------------------------------------
--M--A--K--Q--I--G--A--A--T--Y--I--E--C--S--A--L--Q--S--E--N--S--V--R--D--I--F--H--V--A--T--L--A--C-
TATGGCCAAACAGATTGGAGCAGCTACTTATATCGAATGCTCAGCTTTACAGTCGGAAAATAGCGTCAGAGACATTTTTCACGTTGCCACCTTGGCATGT
:::::::::::::::.::::::::.:::::.:::::::::::::::::::::::.::::::::::::::::::::::::::.::::::::::::::::::
TATGGCCAAACAGATCGGAGCAGCCACTTACATCGAATGCTCAGCTTTACAGTCAGAAAATAGCGTCAGAGACATTTTTCATGTTGCCACCTTGGCATGT
--M--A--K--Q--I--G--A--A--T--Y--I--E--C--S--A--L--Q--S--E--N--S--V--R--D--I--F--H--V--A--T--L--A--C-

----------------------------------------------------------------------------------------------------
-V--N--K--T--N--K--N--V--K--R--N--K--S--Q--R--A--T--K--R--I--S--H--M--P--S--R--P--E--L--S--A--V--A--
GTAAATAAGACAAATAAAAACGTTAAGCGGAACAAATCACAGAGAGCCACAAAGCGGATTTCACACATGCCTAGCAGACCAGAACTCTCGGCAGTTGCTA
::::::::::::::::::::::::::::::::::::::.:::::.:: :::::::::::::::::::::::.::::::::.:::::::::::::: ::::
GTAAATAAGACAAATAAAAACGTTAAGCGGAACAAATCGCAGAGGGCAACAAAGCGGATTTCACACATGCCCAGCAGACCGGAACTCTCGGCAGTGGCTA
-V--N--K--T--N--K--N--V--K--R--N--K--S--Q--R--A--T--K--R--I--S--H--M--P--S--R--P--E--L--S--A--V--A--

------------------------------------------->
T--D--L--R--K--D--K--A--K--S--C--T--V--M--*-
CGGACTTACGAAAGGACAAAGCGAAGAGCTGCACTGTGATGTGA
:::::::::::::::::::::: :::::.:::::::::::::::
CGGACTTACGAAAGGACAAAGCCAAGAGTTGCACTGTGATGTGA
T--D--L--R--K--D--K--A--K--S--C--T--V--M--*-

Pig Consensus Sequence

>BGISUST0000889775
ATGAAGGAGAGAAGAGCCAGCCAGAAATTATCCAGTAAatCTATCATGGATCCTAATCAGAACGTGAAATGCAAGATAGTAGTggTGGGAGATAGTCAGT
GTGGGAAAACCGCgcTGCTGCACGTCTTCGCCAAAGACTGCTTCCCCGAGAATTACGTCCCTACAGTGTTTGAGAATTACACGGCCAGTTTCGAAATCGA
CACACAAAGAATAGAATTGAGCCTGTGGGACACTTCG---TCTCCTTACTATGACAACGTCCGGCCCCTCTCCTACCCAGACTCAGACGCCGTGCTGATT
TGCTTTGACATCAGTAGACCAGAGACTCTGGACAGTGTCCTGAAAAAGTGGAAAGGTGAAATCCAGGAGTTTTGTCCCAACACCAAAATGCTCTTGGTCG
GCTGCAAATCTGATCTTCGGACAGATGTCAGTACATTAGTAGAGCTCTCAAACCACAGGCAGACACCAGTGTCCTACGACCAGGGGGCAAATATGGCCAA
ACAGATCGGAGCAGCCACTTACATCGAATGCTCAGCTTTACAGTCAGAAAATAGCGTCAGAGACATTTTTCATGTTGCCACCTTGGCATGTGTAAATAAG
ACAAATAAAAACGTTAAGCGGAACAAATCGCAGAGGGCAACAAAGCGGATTTCACACATGCCCAGCAGACCGGAACTCTCGGCAGTGGCTACGGACTTAC
GAAAGGACAAAGCCAAGAGTTGCACTGTGATGTGA


>BGISUSP0000889775
MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTS-SPYYDNVRPLSYPDSDAVLI
CFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK
TNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVM*