Sequences
EST Library Info
cst2Stomach - RNA from China
plac4Unavailable
tes6Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000115145 (click for geneview)
Transcript ID ENST00000263904(link to ensembl)
Symbol STAM2
Localtion Chromosome:2:152800615:152858014:-1 band: 2q23.3
Description signal transducing adaptor molecule 2 [Source:RefSeq_peptide;Acc:NP_005834]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------><-----------------------------------------------------------
-M--P--L--F--T--A--N--P--F--E--Q--D--V--E--K--A--T--N--E--Y--N--T--T--E--D--W--S--L--I--M--D--I--C--
ATGCCTTTGTTCACCGCCAACCCCTTCGAGCAAGACGTGGAAAAAGCCACGAATGAGTACAACACTACAGAAGATTGGAGTCTTATTATGGACATATGTG
::::::.::::::::::::::::::::::::::::::::   ::.:::::.::::::::.::::::::::::::::::::::::::::::::::::::.:
ATGCCTCTGTTCACCGCCAACCCCTTCGAGCAAGACGTG---AAGGCCACAAATGAGTATAACACTACAGAAGATTGGAGTCTTATTATGGACATATGCG
-M--P--L--F--T--A--N--P--F--E--Q--D--V-----K--A--T--N--E--Y--N--T--T--E--D--W--S--L--I--M--D--I--C--

------------------------><--------------------------------------------------------------------------
D--K--V--G--S--T--P--N--G--A--K--D--C--L--K--A--I--M--K--R--V--N--H--K--V--P--H--V--A--L--Q--A--L--T
ACAAAGTTGGAAGTACTCCTAATGGAGCGAAAGATTGCCTAAAAGCCATAATGAAAAGGGTAAATCATAAGGTTCCACATGTTGCTCTGCAAGCACTAAC
:.:::::::::::.:::::::::   ::.:::::::::::::::::::::::::::::.:::::.:::::.::::: ::::::::::::::.:::.:.::
ATAAAGTTGGAAGCACTCCTAAT---GCAAAAGATTGCCTAAAAGCCATAATGAAAAGAGTAAACCATAAAGTTCCTCATGTTGCTCTGCAGGCATTGAC
D--K--V--G--S--T--P--N-----A--K--D--C--L--K--A--I--M--K--R--V--N--H--K--V--P--H--V--A--L--Q--A--L--T

><------------------------------------------------------------------------------------------------->
--L--L--G--A--C--V--A--N--C--G--K--I--F--H--L--E--V--C--S--R--D--F--A--T--E--V--R--A--V--I--K--N--K-
TCTTCTTGGGGCTTGTGTGGCAAACTGTGGAAAGATATTTCATTTAGAAGTATGTTCCCGTGATTTTGCAACAGAAGTACGTGCTGTGATTAAAAATAAG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::
TCTTCTTGGGGCTTGTGTGGCAAACTGTGGAAAGATATTTCATTTAGAAGTATGTTCCCGTGATTTTGCAACAGAAGTACGTGCTGTGATAAAAAATAAG
--L--L--G--A--C--V--A--N--C--G--K--I--F--H--L--E--V--C--S--R--D--F--A--T--E--V--R--A--V--I--K--N--K-

<---------------------------------------------------------------------------------------------------
-A--H--P--K--V--C--E--K--L--K--S--L--M--V--E--W--S--E--E--F--Q--K--D--P--Q--F--S--L--I--S--A--T--I--
GCACATCCTAAAGTATGTGAAAAACTGAAATCTTTAATGGTGGAGTGGTCAGAAGAATTTCAGAAGGACCCTCAGTTTAGTCTGATATCTGCAACTATTA
:: ::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: :::::::::::.::::::::::::::::
GCTCATCCTAAAGTATGTGAAAAACTGAAATCTTTAATGGTAGAGTGGTCAGAAGAATTTCAGAAGGACCCACAGTTTAGTCTAATATCTGCAACTATTA
-A--H--P--K--V--C--E--K--L--K--S--L--M--V--E--W--S--E--E--F--Q--K--D--P--Q--F--S--L--I--S--A--T--I--

----------------------------------------------><----------------------------------------------------
K--S--M--K--E--E--G--I--T--F--P--P--A--G--S--Q--T--V--S--A--A--A--K--N--G--T--S--S--N--K--N--K--E--D
AATCTATGAAAGAAGAAGGAATTACTTTTCCTCCAGCAGGTTCTCAGACTGTCTCAGCTGCTGCCAAGAATGGTACGTCATCGAACAAAAACAAAGAGGA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::: :.:::::::::::::: :.::::::.::::::::::::::.::
AATCTATGAAAGAAGAAGGAATTACTTTTCCTCCAGCAGGTTCTCAGACTGTCTCACCCGCTGCCAAGAATGGAATGTCATCAAACAAAAACAAAGAAGA
K--S--M--K--E--E--G--I--T--F--P--P--A--G--S--Q--T--V--S--P--A--A--K--N--G--M--S--S--N--K--N--K--E--D

----------------><----------------------------------------------------------------------------------
--E--D--I--A--K--A--I--E--L--S--L--Q--E--Q--K--Q--Q--H--T--E--T--K--S--L--Y--P--S--S--E--I--Q--L--N-
TGAAGACATAGCTAAAGCTATTGAATTATCGCTGCAAGAACAGAAACAGCAACACACAGAAACAAAATCCTTATATCCATCTTCAGAAATTCAGTTAAAT
::::::::::::::::   :::::::::::..:::::::.:::::.:::::.:::::::::::::::::::::::::::::: :::::::::::::::::
TGAAGACATAGCTAAA---ATTGAATTATCATTGCAAGAGCAGAAGCAGCAGCACACAGAAACAAAATCCTTATATCCATCTGCAGAAATTCAGTTAAAT
--E--D--I--A--K-----I--E--L--S--L--Q--E--Q--K--Q--Q--H--T--E--T--K--S--L--Y--P--S--A--E--I--Q--L--N-

----------------------------------------------------------------------------------------------------
-N--K--V--A--R--K--V--R--A--L--Y--D--F--E--A--V--E--D--N--E--L--T--F--K--H--G--E--I--I--I--V--L--D--
AATAAGGTTGCACGGAAAGTGAGAGCTTTATATGATTTTGAAGCTGTTGAGGACAATGAACTCACCTTTAAACATGGTGAAATAATTATTGTTTTGGATG
:::::.:::::: ::::::::::::: :::::::::::::::::.:::::::::::::::::::::::::::::::::::::: ::::::::::::::::
AATAAAGTTGCAAGGAAAGTGAGAGCGTTATATGATTTTGAAGCCGTTGAGGACAATGAACTCACCTTTAAACATGGTGAAATTATTATTGTTTTGGATG
-N--K--V--A--R--K--V--R--A--L--Y--D--F--E--A--V--E--D--N--E--L--T--F--K--H--G--E--I--I--I--V--L--D--

---><---------------------------------------------------------------------------------------------><
D--S--D--A--N--W--W--K--G--E--N--H--R--G--I--G--L--F--P--S--N--F--V--T--T--N--L--N--I--E--T--E--A--A
ACAGTGATGCCAATTGGTGGAAAGGAGAAAATCACAGAGGAATAGGACTTTTCCCATCCAATTTTGTAACAACTAATTTAAACATAGAGACTGAGGCAGC
::   ::::::::::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::::::::::::::::. ::::::::  
AC---GATGCCAATTGGTGGAAAGGAGAAAATCACAGAGGAATAGGACTCTTCCCATCTAATTTTGTAACAACTAATTTAAACATAGAATCTGAGGCA--
D-----D--A--N--W--W--K--G--E--N--H--R--G--I--G--L--F--P--S--N--F--V--T--T--N--L--N--I--E--S--E--A---

---------------------------------------------------------------------------------><-----------------
--A--V--D--K--L--N--V--I--D--D--D--V--E--E--I--K--K--S--E--P--E--P--V--Y--I--D--E--D--K--M--D--R--A-
GGCTGTGGACAAATTGAATGTAATTGATGATGATGTGGAGGAAATTAAGAAATCAGAGCCTGAGCCTGTTTATATAGATGAGGATAAGATGGATAGAGCC
 ::::::::::::::::::.::::::: :: :: : :::::::: ::::::::::::::::::::::::::::::::::::::::::.::::::::::::
-GCTGTGGACAAATTGAATATAATTGAGGAGGAGGAGGAGGAAAATAAGAAATCAGAGCCTGAGCCTGTTTATATAGATGAGGATAAAATGGATAGAGCC
--A--V--D--K--L--N--I--I--E--E--E--E--E--E--N--K--K--S--E--P--E--P--V--Y--I--D--E--D--K--M--D--R--A-

---------------------------------------------------------------------><-----------------------------
-L--Q--V--L--Q--S--I--D--P--T--D--S--K--P--D--S--Q--D--L--L--D--L--E--D--I--C--Q--Q--M--G--P--M--I--
CTGCAGGTACTTCAGAGTATAGATCCAACAGATTCAAAACCAGACTCCCAAGACCTTTTGGATTTAGAAGATATCTGCCAACAGATGGGTCCAATGATAG
::::::::::: ::::::::::::::::::::::::::::::::::::::.:::::.:::::.::::::   ::.:::::::::::::::::::::::::
CTGCAGGTACTACAGAGTATAGATCCAACAGATTCAAAACCAGACTCCCAGGACCTCTTGGACTTAGAA---ATTTGCCAACAGATGGGTCCAATGATAG
-L--Q--V--L--Q--S--I--D--P--T--D--S--K--P--D--S--Q--D--L--L--D--L--E-----I--C--Q--Q--M--G--P--M--I--

------------------------><--------------------------------------------------------------------------
D--E--K--L--E--E--I--D--R--K--H--S--E--L--S--E--L--N--V--K--V--L--E--A--L--E--L--Y--N--K--L--V--N--E
ATGAAAAACTTGAAGAAATTGATAGGAAGCATTCAGAATTGTCTGAATTGAATGTTAAAGTCCTGGAAGCTCTGGAACTATATAACAAATTGGTGAATGA
::::::::::::::::.::::::   ::::::::::::::::::::::::::::: ::::::.::::.:::::::::::.::::::::.::::::::.::
ATGAAAAACTTGAAGAGATTGAT---AAGCATTCAGAATTGTCTGAATTGAATGTAAAAGTCTTGGAGGCTCTGGAACTGTATAACAAGTTGGTGAACGA
D--E--K--L--E--E--I--D-----K--H--S--E--L--S--E--L--N--V--K--V--L--E--A--L--E--L--Y--N--K--L--V--N--E

------------------------------------------------------------------------------><--------------------
--A--P--V--Y--S--V--Y--S--K--L--H--P--P--A--H--Y--P--P--A--S--S--G--V--P--M--Q--T--Y--P--V--Q--S--H-
AGCACCAGTGTACTCAGTCTATTCAAAGCTCCACCCTCCAGCACATTACCCACCTGCATCATCTGGGGTTCCAATGCAGACATATCCAGTTCAATCACAT
: : :: ::.::.::::::::::::::::: ::.: :.::: ::::::::::::: ::::: :::::::::::.:::::::::::::::::::..:::::
ATCTCCCGTATATTCAGTCTATTCAAAGCTGCATCATTCAGGACATTACCCACCTTCATCAGCTGGGGTTCCAGTGCAGACATATCCAGTTCAGCCACAT
--S--P--V--Y--S--V--Y--S--K--L--H--H--S--G--H--Y--P--P--S--S--A--G--V--P--V--Q--T--Y--P--V--Q--P--H-

----------------------------------------------------------------------------------------------------
-G--G--N--Y--M--G--Q--S--I--H--Q--V--T--V--A--Q--S--Y--S--L--G--P--D--Q--I--G--P--L--R--S--L--P--P--
GGTGGAAACTATATGGGTCAGAGCATTCACCAAGTAACTGTTGCCCAAAGCTATAGCCTAGGACCCGATCAAATTGGTCCACTGAGATCTCTGCCTCCAA
::::::::::::::::::::.::.::::::::::: ::.::::::::.:::::.::::::::::: ::::::::.:::::::::::::::::::::::::
GGTGGAAACTATATGGGTCAAAGTATTCACCAAGTCACCGTTGCCCAGAGCTACAGCCTAGGACCAGATCAAATCGGTCCACTGAGATCTCTGCCTCCAA
-G--G--N--Y--M--G--Q--S--I--H--Q--V--T--V--A--Q--S--Y--S--L--G--P--D--Q--I--G--P--L--R--S--L--P--P--

------------------------------------------------><--------------------------------------------------
N--V--N--S--S--V--T--A--Q--P--A--Q--T--S--Y--L--S--T--G--Q--D--T--V--S--N--P--T--Y--M--N--Q--N--S--N
ATGTGAATTCCTCAGTGACAGCACAGCCTGCTCAAACTTCATATTTAAGCACTGGACAAGACACTGTTTCCAATCCTACTTATATGAACCAGAACTCTAA
.:::::::::::::::::::.::::::::: :::::::.::::::::   .:::::::::::::::::::::::.::.: ::::::::::::::::::::
GTGTGAATTCCTCAGTGACAACACAGCCTGGTCAAACTCCATATTTA---GCTGGACAAGACACTGTTTCCAATTCTGCGTATATGAACCAGAACTCTAA
S--V--N--S--S--V--T--T--Q--P--G--Q--T--P--Y--L-----A--G--Q--D--T--V--S--N--S--A--Y--M--N--Q--N--S--N

----------------------------------------------------------------------------------------------------
--L--Q--S--A--T--G--T--T--A--Y--T--Q--Q--M--G--M--S--V--D--M--S--S--Y--Q--N--T--T--S--N--L--P--Q--L-
CCTACAGTCAGCTACTGGTACAACTGCTTACACACAGCAAATGGGGATGTCTGTGGATATGTCATCTTATCAGAACACTACTTCCAATTTGCCTCAACTG
::: ::.:::::::::::::::.::::::::.:::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::::: ::..::
CCTTCAATCAGCTACTGGTACAGCTGCTTACGCACAGCAGATGGGGATGTCTGTGGATATGTCATCTTACCAGAACACTACTTCCAATTTGCCGCAGTTG
--L--Q--S--A--T--G--T--A--A--Y--A--Q--Q--M--G--M--S--V--D--M--S--S--Y--Q--N--T--T--S--N--L--P--Q--L-

-------------------------------------------------------------------------------->
-A--G--F--P--V--T--V--P--A--H--P--V--A--Q--Q--H--T--N--Y--H--Q--Q-----P--L--L--*-
GCAGGCTTTCCGGTGACAGTTCCAGCTCATCCAGTTGCACAGCAGCACACAAATTACCATCAGCAG---CCTCTCCTTTAG
:::::::::::::::.::::::::::::::.: .::::::::::::: .:::::::::::::::::   :::::::::   
GCAGGCTTTCCGGTGGCAGTTCCAGCTCATTCCATTGCACAGCAGCAAGCAAATTACCATCAGCAGCAGCCTCTCCTT---
-A--G--F--P--V--A--V--P--A--H--S--I--A--Q--Q--Q--A--N--Y--H--Q--Q--Q--P--L--L----

Pig Consensus Sequence

>BGISUST0000888028
ATGCCTCTGTTCACCGCCAACCCCTTCGAGCAAGACGTG---AAGGCCACAAATGAGTATAACACTACAGAAGATTGGAGTCTTATTATGGACATATGCG
ATAAAGTTGGAAGCACTCCTAAT---GCAAAAGATTGCCTAAAAGCCATAATGAAAAGAGTAAACCATAAAGTTCCTCATGTTGCTCTGCAGGCATTGAC
TCTTCTTGGGGCTTGTGTGGCAAACTGTGGAAAGATATTTCATTTAGAAGTATGTTCCCGTGATTTTGCAACAGAAGTACGTGCTGTGATAAAAAATAAG
GCTCATCCTAAAGTATGTGAAAAACTGAAATCTTTAATGGTAGAGTGGTCAGAAGAATTTCAGAAGGACCCACAGTTTAGTCTAATATCTGCAACTATTA
AATCTATGAAAGAAGAAGGAATTACTTTTCCTCCAGCAGGTTCTCAGACTGTCTCACCCGCTGCCAAGAATGGAATGTCATCAAACAAAAACAAAGAAGA
TGAAGACATAGCTAAA---ATTGAATTATCATTGCAAGAGCAGAAGCAGCAGCACACAGAAACAAAATCCTTATATCCATCTGCAGAAATTCAGTTAAAT
AATAAAGTTGCAAGGAAAGTGAGAGCGTTATATGATTTTGAAGCCGTTGAGGACAATGAACTCACCTTTAAACATGGTGAAATTATTATTGTTTTGGATG
AC---GATGCCAATTGGTGGAAAGGAGAAAATCACAGAGGAATAGGACTCTTCCCATCTAATTTTGTAACAACTAATTTAAACATAGAATCTGAGGCA--
-GCTGTGGACAAATTGAATATAATTGAGGAGGAGGAGGAGGAAAATAAGAAATCAGAGCCTGAGCCTGTTTATATAGATGAGGATAAAATGGATAGAGCC
CTGCAGGTACTACAGAGTATAGATCCAACAGATTCAAAACCAGACTCCCAGGACCTCTTGGACTTAGAA---ATTTGCCAACAGATGGGTCCAATGATAG
ATGAAAAACTTGAAGAGATTGAT---AAGCATTCAGAATTGTCTGAATTGAATGTAAAAGTCTTGGAGGCTCTGGAACTGTATAACAAGTTGGTGAACGA
ATCTCCCGTATATTCAGTCTATTCAAAGCTGCATCATTCAGGACATTACCCACCTTCATCAGCTGGGGTTCCAGTGCAGACATATCCAGTTCAGCCACAT
GGTGGAAACTATATGGGTCAAAGTATTCACCAAGTCACCGTTGCCCAGAGCTACAGCCTAGGACCAGATCAAATCGGTCCACTGAGATCTCTGCCTCCAA
GTGTGAATTCCTCAGTGACAACACAGCCTGGTCAAACTCCATATTTA---GCTGGACAAGACACTGTTTCCAATTCTGCGTATATGAACCAGAACTCTAA
CCTTCAATCAGCTACTGGTACAGCTGCTTACGCACAGCAGATGGGGATGTCTGTGGATATGTCATCTTACCAGAACACTACTTCCAATTTGCCGCAGTTG
GCAGGCTTTCCGGTGGCAGTTCCAGCTCATTCCATTGCACAGCAGCAAGCAAATTACCATCAGCAGCAGCCTCTC---


>BGISUSP0000888028
MPLFTANPFEQDV-KATNEYNTTEDWSLIMDICDKVGSTPN-AKDCLKAIMKRVNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNK
AHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEGITFPPAGSQTVSPAAKNGMSSNKNKEDEDIAK-IELSLQEQKQQHTETKSLYPSAEIQLN
NKVARKVRALYDFEAVEDNELTFKHGEIIIVLDD-DANWWKGENHRGIGLFPSNFVTTNLNIESEA-AVDKLNIIEEEEEENKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLE-ICQQMGPMIDEKLEEID-KHSELSELNVKVLEALELYNKLVNESPVYSVYSKLHHSGHYPPSSAGVPVQTYPVQPH
GGNYMGQSIHQVTVAQSYSLGPDQIGPLRSLPPSVNSSVTTQPGQTPYL-AGQDTVSNSAYMNQNSNLQSATGTAAYAQQMGMSVDMSSYQNTTSNLPQL
AGFPVAVPAHSIAQQQANYHQQQPL-