Sequences
EST Library Info
pliv1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000081320 (click for geneview)
Transcript ID ENST00000263955(link to ensembl)
Symbol STK17B
Localtion Chromosome:2:196827373:196861781:-1 band: 2q32.3
Description Serine/threonine-protein kinase 17B (EC 2.7.1.37) (DAP kinase-related apoptosis-inducing protein kinase 2). [Source:Uniprot/SWISSPROT;Acc:O94768]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--R--R--R--F--D--C--R--S--I--S--G--L--L--T--T--T--P--Q--I--P--I--K--M--E--N--F--N--N--F--Y--I--
ATGTCGAGGAGGAGATTTGATTGCCGAAGTATTTCAGGCCTACTAACTACAACTCCTCAAATTCCAATAAAAATGGAAAACTTTAATAATTTCTATATAC
:::::.:::::.:::::::::::::::::::::::::::.:.:::::::::::::::::::.::::::.:::::::: ::::::::::::::.::::.::
ATGTCAAGGAGAAGATTTGATTGCCGAAGTATTTCAGGCTTGCTAACTACAACTCCTCAAACTCCAATGAAAATGGATAACTTTAATAATTTTTATACAC
-M--S--R--R--R--F--D--C--R--S--I--S--G--L--L--T--T--T--P--Q--T--P--M--K--M--D--N--F--N--N--F--Y--T--

---------------------><-----------------------------------------------------------------------------
L--T--S--K--E--L--G--R--G--K--F--A--V--V--R--Q--C--I--S--K--S--T--G--Q--E--Y--A--A--K--F--L--K--K--R
TTACATCTAAAGAGCTAGGGAGAGGAAAATTTGCTGTGGTTAGACAATGTATATCAAAATCTACTGGCCAAGAATATGCTGCAAAATTTCTAAAAAAGAG
:::::::::::::::::      ::::::::::::::::::::.::::::::::: :::::::::::::::::::::::::::::::::::.::::::::
TTACATCTAAAGAGCTA------GGAAAATTTGCTGTGGTTAGGCAATGTATATCCAAATCTACTGGCCAAGAATATGCTGCAAAATTTCTGAAAAAGAG
L--T--S--K--E--L--------G--K--F--A--V--V--R--Q--C--I--S--K--S--T--G--Q--E--Y--A--A--K--F--L--K--K--R

----------------------------------------------------------------------------------------------------
--R--R--G--Q--D--C--R--A--E--I--L--H--E--I--A--V--L--E--L--A--K--S--C--P--R--V--I--N--L--H--E--V--Y-
AAGAAGAGGACAGGATTGTCGAGCAGAAATTTTACACGAGATTGCTGTGCTTGAATTGGCAAAGTCTTGTCCCCGTGTTATTAATCTTCATGAGGTCTAT
:::::::::::::::::::::::::::.:::.::::.:::::::: ::.:::::::::::.:::::.:::::::..:: ::::::::::::::.::::::
AAGAAGAGGACAGGATTGTCGAGCAGAGATTCTACATGAGATTGCAGTACTTGAATTGGCGAAGTCCTGTCCCCACGTGATTAATCTTCATGAAGTCTAT
--R--R--G--Q--D--C--R--A--E--I--L--H--E--I--A--V--L--E--L--A--K--S--C--P--H--V--I--N--L--H--E--V--Y-

----------------------------------><----------------------------------------------------------------
-E--N--T--S--E--I--I--L--I--L--E--Y--A--A--G--G--E--I--F--S--L--C--L--P--E--L--A--E--M--V--S--E--N--
GAAAATACAAGTGAAATCATTTTGATATTGGAATATGCTGCAGGTGGAGAAATTTTCAGCCTGTGTTTACCTGAGTTGGCTGAAATGGTTTCTGAAAATG
::::::.:::::::::::::::::.::::::::   :::::::::::::::::.::::.:.::::::::::::::::::::::::::::.::::::::::
GAAAATGCAAGTGAAATCATTTTGGTATTGGAA---GCTGCAGGTGGAGAAATCTTCAACTTGTGTTTACCTGAGTTGGCTGAAATGGTCTCTGAAAATG
-E--N--A--S--E--I--I--L--V--L--E-----A--A--G--G--E--I--F--N--L--C--L--P--E--L--A--E--M--V--S--E--N--

-------------------------------------------------------------------------------><-------------------
D--V--I--R--L--I--K--Q--I--L--E--G--V--Y--Y--L--H--Q--N--N--I--V--H--L--D--L--K--P--Q--N--I--L--L--S
ATGTTATCAGACTCATTAAACAAATACTTGAAGGAGTTTATTATCTACATCAGAATAACATTGTACACCTTGATTTAAAGCCACAGAATATATTACTGAG
:..:::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::.:.::
ACATTATCAGACTCATTAAACAAATACTTGAAGGAGTTTATTATCTACATCAAAATAACATTGTACACCTTGATTTAAAGCCACAGAATATATTATTAAG
D--I--I--R--L--I--K--Q--I--L--E--G--V--Y--Y--L--H--Q--N--N--I--V--H--L--D--L--K--P--Q--N--I--L--L--S

----------------------------------------------------------------------------------------------------
--S--I--Y--P--L--G--D--I-----K--I--V--D--F--G--M--S--R--K--I--G--H--A--C--E--L--R--E--I--M--G--T--P-
CAGCATATACCCTCTCGGGGACATT---AAAATAGTAGATTTTGGAATGTCTCGAAAAATAGGGCATGCGTGTGAACTTCGGGAAATCATGGGAACACCA
:::::::::::::::.::::::::     ::::.::::::: :::::::::::::::::::::: ::::.::::::::::::::::::::::::::::::
CAGCATATACCCTCTTGGGGACATAA--CAAATGGTAGATTATGGAATGTCTCGAAAAATAGGGAATGCATGTGAACTTCGGGAAATCATGGGAACACCA
--S--I--Y--P--L--G--D--I--\--K--M--V--D--Y--G--M--S--R--K--I--G--N--A--C--E--L--R--E--I--M--G--T--P-

---------><-----------------------------------------------><----------------------------------------
-E--Y--L--A--P--E--I--L--N--Y--D--P--I--T--T--A--T--D--M--W--N--I--G--I--I--A--Y--M--L--L--T--H--T--
GAATATTTAGCTCCAGAAATCCTGAACTATGATCCCATTACCACAGCAACAGATATGTGGAATATTGGTATAATAGCATATATGTTGTTAACTCACACAT
:::                                                                                                 
GAA-------------------------------------------------------------------------------------------------
-E--------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--P--F--V--G--E--D--N--Q--E--T--Y--L--N--I--S--Q--V--N--V--D--Y--S--E--E--T--F--S--S--V--S--Q--L--A
CACCATTTGTGGGAGAAGATAATCAAGAAACATACCTCAATATTTCTCAAGTTAATGTAGATTATTCGGAAGAAACTTTTTCATCAGTTTCACAGCTGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
--T--D--F--I--Q--S--L--L--V--K--N--P--E--K--R--P--T--A--E--I--C--L--S--H--S--W--L--Q--Q--W--D--F--E-
CACAGACTTTATTCAGAGCCTTTTAGTAAAAAATCCAGAGAAAAGACCAACAGCAGAGATATGCCTTTCTCATTCTTGGCTACAGCAGTGGGACTTTGAA
                                        .:::.. :.::::: ::.:: :::::::::::::: ::::::::::::::::::::::.:
----------------------------------------GAAAAGACGACAGCCGAAATCTGCCTTTCTCATTC-TGGCTACAGCAGTGGGACTTTGGA
-----------------------------------------E--K--T--T--A--E--I--C--L--S--H--S--W--L--Q--Q--W--D--F--G-

----------------------------------------------------------------------------------------------------
-N--L--F--H--P--E--E--T--S--S--S--S--Q--T--Q--D--H--S--V--R--S--S--E--D--K--T--S--K--S--S--C--N--G--
AACTTGTTTCACCCTGAAGAAACTTCCAGTTCCTCTCAAACTCAGGATCATTCTGTAAGGTCCTCTGAAGACAAGACTTCTAAATCCTCCTGTAATGGAA
:::::::::::::::::::::::::::::::::::::::: :::::::::: : .:::::::.:::::::::::::::::::::.:::::::::::::::
AACTTGTTTCACCCTGAAGAAACTTCCAGTTCCTCTCAAAGTCAGGATCATACAATAAGGTCTTCTGAAGACAAGACTTCTAAACCCTCCTGTAATGGAA
-N--L--F--H--P--E--E--T--S--S--S--S--Q--S--Q--D--H--T--I--R--S--S--E--D--K--T--S--K--P--S--C--N--G--

----------------------------------------------------------------------------------------------------
T--C--G--D--R--E--D--K--E--N--I--P--E--D--S--S--M--V--S--K--R--F--R--F--D--D--S--L--P--N--P--H--E--L
CCTGTGGTGATAGAGAAGACAAAGAGAATATCCCAGAGGATAGCAGCATGGTTTCCAAAAGATTTCGTTTCGATGACTCATTACCCAATCCCCATGAACT
::::..::::. ::::::::::::::::.:::::.::::::::::::::::: ::::::::::::::.::.:::::::::::.:::::::::::::::::
CCTGCAGTGACCGAGAAGACAAAGAGAACATCCCGGAGGATAGCAGCATGGTGTCCAAAAGATTTCGCTTTGATGACTCATTGCCCAATCCCCATGAACT
T--C--S--D--R--E--D--K--E--N--I--P--E--D--S--S--M--V--S--K--R--F--R--F--D--D--S--L--P--N--P--H--E--L

----------------------
--V--S--D--L--L--C--*-
TGTTTCAGATTTGCTCTGTTAG
::::::::::::::::::::::
TGTTTCAGATTTGCTCTGTTAG
--V--S--D--L--L--C--*-

Pig Consensus Sequence

>BGISUST0000897874
ATGTCAAGGAGAAGATTTGATTGCCGAAGTATTTCAGGCTTGCTAACTACAACTCCTCAAACTCCAATGAAAATGGATAACTTTAATAATTTTTATACAC
TTACATCTAAAGAGCTA------GGAAAATTTGCTGTGGTTAGGCAATGTATATCCAAATCTACTGGCCAAGAATATGCTGCAAAATTTCTGAAAAAGAG
AAGAAGAGGACAGGATTGTCGAGCAGAGATTCTACATGAGATTGCAGTACTTGAATTGGCGAAGTCCTGTCCCCACGTGATTAATCTTCATGAAGTCTAT
GAAAATGCAAGTGAAATCATTTTGGTATTGGAA---GCTGCAGGTGGAGAAATCTTCAACTTGTGTTTACCTGAGTTGGCTGAAATGGTCTCTGAAAATG
ACATTATCAGACTCATTAAACAAATACTTGAAGGAGTTTATTATCTACATCAAAATAACATTGTACACCTTGATTTAAAGCCACAGAATATATTATTAAG
CAGCATATACCCTCTTGGGGACATacAAATGGTAGATTATGGAATGTCTCGAAAAATAGGGAATGCATGTGAACTTCGGGAAATCATGGGAACACCAGAA
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------GAAAAGACGACAGCCGAAATCTGCCTTTCTCAttGGCTACAGCAGTGGGACTTTGGAAACTTG
TTTCACCCTGAAGAAACTTCCAGTTCCTCTCAAAGTCAGGATCATACAATAAGGTCTTCTGAAGACAAGACTTCTAAACCCTCCTGTAATGGAACCTGCA
GTGACCGAGAAGACAAAGAGAACATCCCGGAGGATAGCAGCATGGTGTCCAAAAGATTTCGCTTTGATGACTCATTGCCCAATCCCCATGAACTTGTTTC
AGATTTGCTCTGTTAG


>BGISUSP0000897874
MSRRRFDCRSISGLLTTTPQTPMKMDNFNNFYTLTSKEL--GKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELAKSCPHVINLHEVY
ENASEIILVLE-AAGGEIFNLCLPELAEMVSENDIIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIQMVDYGMSRKIGNACELREIMGTPE
-------------------------------------------------------------------------------EKTTAEICLSHWLQQWDFGNL
FHPEETSSSSQSQDHTIRSSEDKTSKPSCNGTCSDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLLC*