Sequences
EST Library Info
cbl1Blood
eep2Foetus 50 days, epidermis
fat1Fatt
nep1Newborn 115 days, epidermis
pigca1Unavailable
pigcb1Unavailable
spc1Spinal cord
spl1Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000095139 (click for geneview)
Transcript ID ENST00000264028(link to ensembl)
Symbol ARCN1
Localtion Chromosome:11:117948321:117978852:1 band: 11q23.3
Description Coatomer delta subunit (Delta-coat protein) (Delta-COP) (Archain). [Source:Uniprot/SWISSPROT;Acc:P48444]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-><------------------------------------------------------------------------------------------------
-M--V--L--L--A--A--A--V--C--T--K--A--G--K--A--I--V--S--R--Q--F--V--E--M--T--R--T--R--I--E--G--L--L--
ATGGTGCTGTTGGCAGCAGCGGTCTGCACAAAAGCAGGAAAGGCTATTGTTTCTCGACAGTTTGTGGAAATGACCCGAACTCGGATTGAGGGCTTATTAG
   :::.::::::::::::::::::::::.:::::::::::::::::::::::::::::.:::::.::.::::::::::::::::::::::::::.::::
---GTGTTGTTGGCAGCAGCGGTCTGCACGAAAGCAGGAAAGGCTATTGTTTCTCGACAATTTGTAGAGATGACCCGAACTCGGATTGAGGGCTTGTTAG
----V--L--L--A--A--A--V--C--T--K--A--G--K--A--I--V--S--R--Q--F--V--E--M--T--R--T--R--I--E--G--L--L--

----------------------------------------------------------------------------------------------------
A--A--F--P--K--L--M--N--T--G--K--Q--H--T--F--V--E--T--E--S--V--R--Y--V--Y--Q--P--M--E--K--L--Y--M--V
CAGCTTTTCCAAAGCTCATGAACACTGGAAAACAACATACGTTTGTTGAAACAGAGAGTGTAAGATATGTCTACCAGCCTATGGAGAAACTGTATATGGT
::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.:: ::::::::.:::::.:::::::::::::::::.:::::
CAGCTTTTCCAAAGCTCATGAACACTGGAAAACAACATACATTTGTTGAAACAGAGAGCGTCAGATATGTTTACCAACCTATGGAGAAACTGTACATGGT
A--A--F--P--K--L--M--N--T--G--K--Q--H--T--F--V--E--T--E--S--V--R--Y--V--Y--Q--P--M--E--K--L--Y--M--V

------------------------------------------------------------------><--------------------------------
--L--I--T--T--K--N--S--N--I--L--E--D--L--E--T--L--R--L--F--S--R--V--I--P--E--Y--C--R--A--L--E--E--N-
ACTGATCACTACCAAAAACAGCAACATTTTAGAAGATTTGGAGACCCTAAGGCTCTTCTCAAGAGTGATCCCTGAATATTGCCGAGCCTTAGAAGAGAAT
::::::::::::::::::::::::.::.:::::::::.:::::::.:::::::::::.:::::::::::.::::::::::::::::::::.:::::::::
ACTGATCACTACCAAAAACAGCAATATCTTAGAAGATCTGGAGACTCTAAGGCTCTTTTCAAGAGTGATTCCTGAATATTGCCGAGCCTTGGAAGAGAAT
--L--I--T--T--K--N--S--N--I--L--E--D--L--E--T--L--R--L--F--S--R--V--I--P--E--Y--C--R--A--L--E--E--N-

----------------------------------------------------------------------------------------------------
-E--I--S--E--H--C--F--D--L--I--F--A--F--D--E--I--V--A--L--G--Y--R--E--N--V--N--L--A--Q--I--R--T--F--
GAAATATCTGAGCACTGTTTTGATTTGATTTTTGCTTTTGATGAAATTGTCGCACTGGGATACCGGGAGAATGTTAACTTGGCACAGATCAGAACCTTCA
::::::::::::::::::::::::::::::::::: ::::::::::::::.:: :: :::::::::::::::::::::.::::::::::::::::.::::
GAAATATCTGAGCACTGTTTTGATTTGATTTTTGCATTTGATGAAATTGTTGCCCTCGGATACCGGGAGAATGTTAACCTGGCACAGATCAGAACTTTCA
-E--I--S--E--H--C--F--D--L--I--F--A--F--D--E--I--V--A--L--G--Y--R--E--N--V--N--L--A--Q--I--R--T--F--

----------------------------------------------><----------------------------------------------------
T--E--M--D--S--H--E--E--K--V--F--R--A--V--R--E--T--Q--E--R--E--A--K--A--E--M--R--R--K--A--K--E--L--Q
CAGAAATGGATTCTCATGAGGAGAAGGTGTTCAGAGCCGTCAGAGAGACTCAAGAACGTGAAGCTAAGGCTGAGATGCGTCGTAAAGCAAAGGAATTACA
::::::::::::::::::::::::::::::::::::: :: :::::::::::::::::::::::.:::::::::::::: ::::::::::::::.:::::
CAGAAATGGATTCTCATGAGGAGAAGGTGTTCAGAGCAGTGAGAGAGACTCAAGAACGTGAAGCCAAGGCTGAGATGCGGCGTAAAGCAAAGGAGTTACA
T--E--M--D--S--H--E--E--K--V--F--R--A--V--R--E--T--Q--E--R--E--A--K--A--E--M--R--R--K--A--K--E--L--Q

----------------------------------------------------------------------------------------------------
--Q--A--R--R--D--A--E--R--Q--G--K--K--A--P--G--F--G--G--F--G--S--S--A--V--S--G--G--S--T--A--A--M--I-
ACAGGCCCGAAGAGATGCAGAGAGACAGGGCAAAAAAGCACCAGGATTTGGCGGATTTGGCAGCTCTGCAGTATCTGGAGGCAGCACAGCTGCCATGATC
:::::::::::::::::::::.::::::::::::::::::::::::::::: :::::::: :::::..:::::::::::.:::::::::::::.::::::
ACAGGCCCGAAGAGATGCAGAAAGACAGGGCAAAAAAGCACCAGGATTTGGGGGATTTGGAAGCTCCACAGTATCTGGAAGCAGCACAGCTGCTATGATC
--Q--A--R--R--D--A--E--R--Q--G--K--K--A--P--G--F--G--G--F--G--S--S--T--V--S--G--S--S--T--A--A--M--I-

----------------------------------------------------><----------------------------------------------
-T--E--T--I--I--E--T--D--K--P--K--V--A--P--A--P--A--R--P--S--G--P--S--K--A--L--K--L--G--A--K--G--K--
ACAGAGACCATCATTGAAACTGATAAACCAAAAGTGGCACCTGCACCAGCCAGGCCTTCAGGCCCCAGCAAGGCTTTAAAACTTGGAGCCAAAGGAAAGG
:::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::.:::::.:::::.::::: ::::::::::::::::
ACAGAGACCATCATTGAAACTGATAAACCAAAAGTGGCACCTGCACCAGCC---CCTTCAGGCCCTAGCAAAGCTTTGAAACTGGGAGCCAAAGGAAAGG
-T--E--T--I--I--E--T--D--K--P--K--V--A--P--A--P--A-----P--S--G--P--S--K--A--L--K--L--G--A--K--G--K--

----------------------------------------------------------------------------------------------------
E--V--D--N--F--V--D--K--L--K--S--E--G--E--T--I--M--S--S--S--M--G--K--R--T--S--E--A--T--K--M--H--A--P
AAGTAGATAACTTTGTGGACAAATTAAAATCTGAAGGTGAAACCATCATGTCCTCTAGTATGGGCAAGCGTACTTCTGAAGCAACCAAAATGCATGCTCC
:::::::::::::::::::::::::.:::::::::::::::::.:::::::::::.:.:::::::::::::::.::::: :::::::::.::::::::::
AAGTAGATAACTTTGTGGACAAATTGAAATCTGAAGGTGAAACTATCATGTCCTCCAATATGGGCAAGCGTACCTCTGATGCAACCAAAGTGCATGCTCC
E--V--D--N--F--V--D--K--L--K--S--E--G--E--T--I--M--S--S--N--M--G--K--R--T--S--D--A--T--K--V--H--A--P

-----------------><---------------------------------------------------------------------------------
--P--I--N--M--E--S--V--H--M--K--I--E--E--K--I--T--L--T--C--G--R--D--G--G--L--Q--N--M--E--L--H--G--M-
ACCCATTAATATGGAAAGTGTACATATGAAGATTGAAGAAAAGATAACATTAACCTGTGGACGAGACGGAGGATTACAGAATATGGAGTTGCATGGCATG
 :::::::::::::::   ::.::.:::::::::::.:::::::: :::.::::::::::.:::::.::::::::::::::::::::::::::.::::::
TCCCATTAATATGGAA---GTGCACATGAAGATTGAGGAAAAGATCACACTAACCTGTGGGCGAGATGGAGGATTACAGAATATGGAGTTGCACGGCATG
--P--I--N--M--E-----V--H--M--K--I--E--E--K--I--T--L--T--C--G--R--D--G--G--L--Q--N--M--E--L--H--G--M-

-----------------------------------------------------------------------------------><---------------
-I--M--L--R--I--S--D--D--K--Y--G--R--I--R--L--H--V--E--N--E--D--K--K--G--V--Q--L--Q--T--H--P--N--V--
ATCATGCTTAGGATCTCAGATGACAAGTATGGCCGAATTCGTCTTCATGTGGAAAATGAAGATAAGAAAGGGGTGCAGCTACAGACCCATCCAAATGTGG
:::::::::::::::::::::::.::.: :::::::::::: :::::::::::::::::::::::::::::::::::.::::::::::::::::::::::
ATCATGCTTAGGATCTCAGATGATAAATTTGGCCGAATTCGACTTCATGTGGAAAATGAAGATAAGAAAGGGGTGCAACTACAGACCCATCCAAATGTGG
-I--M--L--R--I--S--D--D--K--F--G--R--I--R--L--H--V--E--N--E--D--K--K--G--V--Q--L--Q--T--H--P--N--V--

----------------------------------------------------------------------------------------------------
D--K--K-----L--F--T--A--E--S--L--I--G--L--K--N--P--E--K--S--F--P--V--N--S--D--V--G--V--L--K--W--R--L
ATAAAAAA---CTTTTCACTGCAGAGTCTCTAATTGGCCTGAAGAATCCAGAGAAGTCATTTCCAGTCAACAGTGACGTAGGGGTGCTAAAGTGGAGACT
::::::::   ::::::::::::::.::::: ::::::.:::::::::::::::::::::::::::::::::::::.:::::.:::::::::::::::::
ATAAAAAAA--CTTTTCACTGCAGAATCTCTCATTGGCTTGAAGAATCCAGAGAAGTCATTTCCAGTCAACAGTGATGTAGGAGTGCTAAAGTGGAGACT
D--K--K--\--L--F--T--A--E--S--L--I--G--L--K--N--P--E--K--S--F--P--V--N--S--D--V--G--V--L--K--W--R--L

----------------------------------><----------------------------------------------------------------
--Q--T--T--E--E--S--F--I--P--L--T--I--N--C--W--P--S--E--S--G--N--G--C--D--V--N--I--E--Y--E--L--Q--E-
ACAAACCACAGAGGAATCTTTTATTCCACTGACAATTAATTGCTGGCCCTCGGAGAGTGGAAATGGCTGTGATGTCAACATAGAATATGAGCTACAAGAA
::::::::::::::::::::::::::::::::::   :::::::::::::::::.:::::::::::.:::::::::::::::::::::::.::.::::::
ACAAACCACAGAGGAATCTTTTATTCCACTGACA---AATTGCTGGCCCTCGGAAAGTGGAAATGGTTGTGATGTCAACATAGAATATGAACTGCAAGAA
--Q--T--T--E--E--S--F--I--P--L--T-----N--C--W--P--S--E--S--G--N--G--C--D--V--N--I--E--Y--E--L--Q--E-

-------------------------------------------><-------------------------------------------------------
-D--N--L--E--L--N--D--V--V--I--T--I--P--L--P--S--G--V--G--A--P--V--I--G--E--I--D--G--E--Y--R--H--D--
GATAATTTAGAACTGAATGATGTGGTTATCACCATCCCACTCCCGTCTGGTGTCGGCGCGCCTGTTATCGGTGAGATCGATGGGGAGTATCGACATGACA
::::::::::::::::::::::::.:::::::::::::::::   ::::::::.::.::.:: :: ::.::.::.::.::::: ::::::::::::::::
GATAATTTAGAACTGAATGATGTGATTATCACCATCCCACTC---TCTGGTGTTGGTGCACCGGTGATTGGCGAAATTGATGGCGAGTATCGACATGACA
-D--N--L--E--L--N--D--V--I--I--T--I--P--L-----S--G--V--G--A--P--V--I--G--E--I--D--G--E--Y--R--H--D--

----------------------------------------------------------------------------------------------------
S--R--R--N--T--L--E--W--C--L--P--V--I--D--A--K--N--K--S--G--S--L--E--F--S--I--A--G--Q--P--N--D--F--F
GTCGACGAAATACCCTGGAGTGGTGCCTGCCTGTGATTGATGCCAAAAATAAGAGTGGCAGCCTGGAGTTTAGCATTGCTGGGCAGCCCAATGACTTCTT
:::::::::::::..:::::::::::::::: :::::::::::::::::::::::.:::::::: :::::.::::::::::::::::::::.::.:::::
GTCGACGAAATACTTTGGAGTGGTGCCTGCCAGTGATTGATGCCAAAAATAAGAGCGGCAGCCTTGAGTTCAGCATTGCTGGGCAGCCCAACGATTTCTT
S--R--R--N--T--L--E--W--C--L--P--V--I--D--A--K--N--K--S--G--S--L--E--F--S--I--A--G--Q--P--N--D--F--F

------------------------------------------------><--------------------------------------------------
--P--V--Q--V--S--F--V--S--K--K--N--Y--C--N--I--Q--V--T--K--V--T--Q-----V--D--G--N--S--P--V--R--F--S-
CCCTGTTCAAGTTTCCTTTGTCTCCAAGAAAAATTACTGTAACATACAGGTTACCAAAGTGACCCAG---GTAGATGGAAACAGCCCCGTCAGGTTTTCC
::::::::::::.:::::.::::::::.:::::::::::::::::::::::::::::::::::::::   :::::::::::::::::.:: :::::::::
CCCTGTTCAAGTCTCCTTCGTCTCCAAAAAAAATTACTGTAACATACAGGTTACCAAAGTGACCCAGT--GTAGATGGAAACAGCCCTGTAAGGTTTTCC
--P--V--Q--V--S--F--V--S--K--K--N--Y--C--N--I--Q--V--T--K--V--T--Q--\--V--D--G--N--S--P--V--R--F--S-

----------------------------------------->
-T--E--T--T--F--L--V--D--K--Y--E--I--L--*-
ACAGAGACCACTTTCCTAGTGGATAAGTATGAAATTCTGTAA
::::::::::::::::::::::::::::::::::::::::::
ACAGAGACCACTTTCCTAGTGGATAAGTATGAAATTCTGTAA
-T--E--T--T--F--L--V--D--K--Y--E--I--L--*-

Pig Consensus Sequence

>BGISUST0000877576
---GTGTTGTTGGCAGCAGCGGTCTGCACGAAAGCAGGAAAGGCTATTGTTTCTCGACAATTTGTAGAGATGACCCGAACTCGGATTGAGGGCTTGTTAG
CAGCTTTTCCAAAGCTCATGAACACTGGAAAACAACATACATTTGTTGAAACAGAGAGCGTCAGATATGTTTACCAACCTATGGAGAAACTGTACATGGT
ACTGATCACTACCAAAAACAGCAATATCTTAGAAGATCTGGAGACTCTAAGGCTCTTTTCAAGAGTGATTCCTGAATATTGCCGAGCCTTGGAAGAGAAT
GAAATATCTGAGCACTGTTTTGATTTGATTTTTGCATTTGATGAAATTGTTGCCCTCGGATACCGGGAGAATGTTAACCTGGCACAGATCAGAACTTTCA
CAGAAATGGATTCTCATGAGGAGAAGGTGTTCAGAGCAGTGAGAGAGACTCAAGAACGTGAAGCCAAGGCTGAGATGCGGCGTAAAGCAAAGGAGTTACA
ACAGGCCCGAAGAGATGCAGAAAGACAGGGCAAAAAAGCACCAGGATTTGGGGGATTTGGAAGCTCCACAGTATCTGGAAGCAGCACAGCTGCTATGATC
ACAGAGACCATCATTGAAACTGATAAACCAAAAGTGGCACCTGCACCAGCC---CCTTCAGGCCCTAGCAAAGCTTTGAAACTGGGAGCCAAAGGAAAGG
AAGTAGATAACTTTGTGGACAAATTGAAATCTGAAGGTGAAACTATCATGTCCTCCAATATGGGCAAGCGTACCTCTGATGCAACCAAAGTGCATGCTCC
TCCCATTAATATGGAA---GTGCACATGAAGATTGAGGAAAAGATCACACTAACCTGTGGGCGAGATGGAGGATTACAGAATATGGAGTTGCACGGCATG
ATCATGCTTAGGATCTCAGATGATAAATTTGGCCGAATTCGACTTCATGTGGAAAATGAAGATAAGAAAGGGGTGCAACTACAGACCCATCCAAATGTGG
ATAAAAAacTTTTCACTGCAGAATCTCTCATTGGCTTGAAGAATCCAGAGAAGTCATTTCCAGTCAACAGTGATGTAGGAGTGCTAAAGTGGAGACTACA
AACCACAGAGGAATCTTTTATTCCACTGACA---AATTGCTGGCCCTCGGAAAGTGGAAATGGTTGTGATGTCAACATAGAATATGAACTGCAAGAAGAT
AATTTAGAACTGAATGATGTGATTATCACCATCCCACTC---TCTGGTGTTGGTGCACCGGTGATTGGCGAAATTGATGGCGAGTATCGACATGACAGTC
GACGAAATACTTTGGAGTGGTGCCTGCCAGTGATTGATGCCAAAAATAAGAGCGGCAGCCTTGAGTTCAGCATTGCTGGGCAGCCCAACGATTTCTTCCC
TGTTCAAGTCTCCTTCGTCTCCAAAAAAAATTACTGTAACATACAGGTTACCAAAGTGACCCAggTAGATGGAAACAGCCCTGTAAGGTTTTCCACAGAG
ACCACTTTCCTAGTGGATAAGTATGAAATTCTGTAA


>BGISUSP0000877576
-VLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETESVRYVYQPMEKLYMVLITTKNSNILEDLETLRLFSRVIPEYCRALEEN
EISEHCFDLIFAFDEIVALGYRENVNLAQIRTFTEMDSHEEKVFRAVRETQEREAKAEMRRKAKELQQARRDAERQGKKAPGFGGFGSSTVSGSSTAAMI
TETIIETDKPKVAPAPA-PSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSNMGKRTSDATKVHAPPINME-VHMKIEEKITLTCGRDGGLQNMELHGM
IMLRISDDKFGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLT-NCWPSESGNGCDVNIEYELQED
NLELNDVIITIPL-SGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTE
TTFLVDKYEIL*