Sequences
EST Library Info
cje2Jejunum - RNA from China
jej1Small intestine, jejunum
med2Mediastinum
Clusters
Oligos
SNPs

Gene ID ENSG00000118094 (click for geneview)
Transcript ID ENST00000264029(link to ensembl)
Symbol TREH
Localtion Chromosome:11:118034209:118055592:-1 band: 11q23.3
Description Trehalase precursor (EC 3.2.1.28) (Alpha,alpha-trehalase) (Alpha,alpha-trehalose glucohydrolase). [Source:Uniprot/SWISSPROT;Acc:O43280]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------><----------
-M--P--G--R--T--W--E--L--C--L--L--L--L--L--G--L--G--L--G--S--Q--E--A--L--P--P--P--C--E--S--E--I--Y--
ATGCCAGGGAGGACCTGGGAGCTGTGCCTGCTACTGCTGCTGGGGCTGGGACTGGGGTCCCAGGAGGCCCTACCCCCACCCTGTGAGAGTGAGATTTACT
                                                                                           :::::::::
------------------------------------------------------------------------------------------CAGATTTACT
-------------------------------------------------------------------------------------------Q--I--Y--

-----------------------------------------------------------------------------------------><---------
C--H--G--E--L--L--N--Q--V--Q--M--A--K--L--Y--Q--D--D--K--Q--F--V--D--M--P--L--S--I--A--P--E--Q--V--L
GCCACGGGGAGCTCCTAAACCAAGTTCAAATGGCCAAGCTCTACCAGGATGACAAGCAGTTTGTGGACATGCCACTGTCTATAGCTCCAGAACAAGTCCT
::::::::::::::::. .:::.:::::.:::::::.:::::::::::::::. ::::.::::::::.::::::.::::..::::::::           
GCCACGGGGAGCTCCTGCGCCAGGTTCAGATGGCCAGGCTCTACCAGGATGATNAGCAATTTGTGGATATGCCATTGTCCGTAGCTCCA-----------
C--H--G--E--L--L--R--Q--V--Q--M--A--R--L--Y--Q--D--D--X--Q--F--V--D--M--P--L--S--V--A--P------------

----------------------------------------------------------------------------------------------------
--Q--T--F--T--E--L--S--R--D--H--N--H--S--I--P--R--E--Q--L--Q--A--F--V--H--E--H--F--Q--A--K--G--Q--E-
GCAGACCTTCACTGAGCTGTCCAGGGACCACAATCACAGCATCCCCAGGGAGCAGCTGCAGGCGTTTGTCCACGAACACTTCCAGGCCAAGGGGCAGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
-L--Q--P--W--T--P--A--D--W--K--D--S--P--Q--F--L--Q--K--I--S--D--A--K--L--R--A--W--A--G--Q--L--H--Q--
CTGCAGCCCTGGACCCCTGCAGACTGGAAAGACAGCCCCCAGTTCCTGCAGAAGATTTCAGATGCCAAACTGCGTGCCTGGGCAGGGCAGCTGCATCAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------><----------------------------------------------------------------------------
L--W--K--K--L--G--K--K--M--K--P--E--V--L--S--H--P--E--R--F--S--L--I--Y--S--E--H--P--F--I--V--P--G--G
TCTGGAAGAAGCTGGGGAAGAAGATGAAGCCAGAGGTTCTCAGCCACCCTGAGCGGTTCTCTCTCATCTACTCAGAACATCCCTTCATTGTGCCTGGCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
--R--F--V--E--F--Y--Y--W--D--S--Y--W--V--M--E--G--L--L--L--S--E--M--A--E--T--V--K--G--M--L--Q--N--F-
TCGCTTTGTTGAGTTCTACTACTGGGACTCCTACTGGGTCATGGAGGGTCTGCTCCTCTCAGAGATGGCTGAGACGGTGAAGGGCATGCTGCAGAACTTC
                         :::::::::::::: ::::::::::::::::: :: :::::: : : ::::::::::::::::::::::::::::
-------------------------GACTCCTACTGGGTGATGGAGGGTCTGCTCCTGTCCGAGATGCCAGTGACGGTGAAGGGCATGCTGCAGAACTTC
--------------------------D--S--Y--W--V--M--E--G--L--L--L--S--E--M--P--V--T--V--K--G--M--L--Q--N--F-

----------------><----------------------------------------------------------------------------------
-L--D--L--V--K--T--Y--G--H--V--P--N--G--G--R--V--Y--Y--L--Q--R--S--Q--P--P--L--L--T--L--M--M--D--C--
TTGGACCTGGTGAAAACCTATGGGCATGTCCCCAATGGTGGGCGCGTGTACTACCTGCAGCGGAGCCAGCCCCCACTCTTGACCCTCATGATGGATTGCT
.:::::.:::::      ::.::.::.::::::::.:: :  ::::::::::::::::::::::::::::::::.:::.::: :::::::::::: .:::
CTGGACTTGGTG------TACGGACACGTCCCCAACGGGGCCCGCGTGTACTACCTGCAGCGGAGCCAGCCCCCGCTCCTGAGCCTCATGATGGAGCGCT
-L--D--L--V--------Y--G--H--V--P--N--G--A--R--V--Y--Y--L--Q--R--S--Q--P--P--L--L--S--L--M--M--E--R--

---------------------------------><-----------------------------------------------------------------
Y--L--T--H--T--N--D--T--A--F--L--Q--E--N--I--E--T--L--A--L--E--L--D--F--W--T--K--N--R--T--V--S--V--S
ACTTGACTCACACCAATGACACCGCCTTTCTACAGGAAAACATTGAAACACTAGCCTTGGAATTGGACTTTTGGACCAAGAACAGGACTGTCTCTGTGAG
:: ::::::: .:::::::::::            :: ::: : ::.:: ::.::::::::.::::::::::::::::::::::::: ..::::::::::
ACGTGACTCAGGCCAATGACACC------------GACAACCTGGAGACCCTGGCCTTGGAGTTGGACTTTTGGACCAAGAACAGGAGCATCTCTGTGAG
Y--V--T--Q--A--N--D--T--------------D--N--L--E--T--L--A--L--E--L--D--F--W--T--K--N--R--S--I--S--V--S

--------------------------------------------------------><------------------------------------------
--L--E--G--K--N--Y--L--L--N--R--Y--Y--V--P--Y--G--G--P--R--P--E--S--Y--S--K--D--V--E--L--A--D--T--L-
CTTGGAGGGAAAGAACTACCTCCTGAATCGCTATTATGTCCCTTATGGGGGACCCAGGCCTGAGTCCTACAGCAAAGATGTGGAGTTGGCTGACACCTTG
::. :.::::::::.::::                                                                                 
CTCTGGGGGAAAGAGCTAC---------------------------------------------------------------------------------
--S--G--G--K--S--Y----------------------------------------------------------------------------------

------><--------------------------------------------------------------------------------------------
-P--E--G--D--R--E--A--L--W--A--E--L--K--A--G--A--E--S--G--W--D--F--S--S--R--W--L--I--G--G--P--N--P--
CCAGAAGGAGACCGGGAGGCTCTGTGGGCTGAGCTCAAGGCTGGGGCTGAGTCTGGCTGGGACTTCTCTTCACGCTGGCTCATTGGAGGCCCAAACCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--S--L--S--G--I--R--T--S--K--L--V--P--V--D--L--N--A--F--L--C--Q--A--E--E--L--M--S--N--F--Y--S--R--L
ACTCGCTTAGCGGCATCCGAACAAGCAAACTGGTGCCTGTTGACCTGAATGCCTTCCTATGCCAAGCAGAGGAGCTGATGAGCAACTTCTATTCCAGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-><-------------------------------------------------------------------------------------------------
--G--N--D--S--Q--A--T--K--Y--R--I--L--R--S--Q--R--L--A--A--L--N--T--V--L--W--D--E--Q--T--G--A--W--F-
GGGGAACGACTCCCAGGCCACGAAGTACAGAATCCTGCGGTCGCAGCGCTTGGCCGCCCTGAACACAGTCCTGTGGGATGAGCAGACCGGAGCCTGGTTC
    ::.::::::::.::.. ::::::::::: ..::::. :.:::::: :::::::: :::: .  .:::::::::::::: :::  :: ::::::::.
----AATGACTCCCAAGCTGAGAAGTACAGAAATTTGCGAGCACAGCGCATGGCCGCCATGAAGGACATCCTGTGGGATGAGGAGAAAGGTGCCTGGTTT
-----N--D--S--Q--A--E--K--Y--R--N--L--R--A--Q--R--M--A--A--M--K--D--I--L--W--D--E--E--K--G--A--W--F-

----------------------------------------------------------------------------------------------------
-D--Y--D--L--E--K--K--K--K--N--R--E--F--Y--P--S--N--L--T--P--L--W--A--G--C--F--S--D--P--G--V--A--D--
GATTACGACCTTGAGAAGAAGAAGAAAAACCGGGAGTTTTACCCATCCAACCTCACTCCACTCTGGGCCGGGTGTTTCTCTGACCCTGGCGTGGCGGACA
::.::.::::::::::: ...:::::.::::  :::::::::::::::::::::.::::.::::::::.:: ::.::::::::::: ::::  :.:::::
GACTATGACCTTGAGAACGGAAAGAAGAACCTTGAGTTTTACCCATCCAACCTCGCTCCGCTCTGGGCTGGCTGCTTCTCTGACCCAGGCGACGTGGACA
-D--Y--D--L--E--N--G--K--K--N--L--E--F--Y--P--S--N--L--A--P--L--W--A--G--C--F--S--D--P--G--D--V--D--

-------------------><-------------------------------------------------------------------------------
K--A--L--K--Y--L--E--D--N--R--I--L--T--Y--Q--Y--G--I--P--T--S--L--Q--K--T--G--Q--Q--W--D--F--P--N--A
AGGCTCTGAAATACCTGGAGGACAACCGGATCCTGACTTACCAGTATGGGATCCCGACCTCTCTCCAGAAGACAGGCCAGCAGTGGGATTTCCCCAATGC
::::::::::::::::::::::::.::.:::::: ::.::::: ::.::.::::::::::::::::.:::::::::::::::::::::.::::::::.::
AGGCTCTGAAATACCTGGAGGACAGCCAGATCCTCACCTACCACTACGGAATCCCGACCTCTCTCCGGAAGACAGGCCAGCAGTGGGACTTCCCCAACGC
K--A--L--K--Y--L--E--D--S--Q--I--L--T--Y--H--Y--G--I--P--T--S--L--R--K--T--G--Q--Q--W--D--F--P--N--A

-------------------------------><-------------------------------------------------------------------
--W--A--P--L--Q--D--L--V--I--R--G--L--A--K--A--P--L--R--R--A--Q--E--V--A--F--Q--L--A--Q--N--W--I--R-
CTGGGCCCCCCTGCAGGACCTGGTCATCAGAGGCCTGGCCAAGGCACCTTTACGTCGGGCCCAGGAAGTGGCTTTCCAGCTGGCTCAGAATTGGATCCGA
:::::::::::::::::::::::::::::::   ::::::::: : ::::.:  . :.::::::::::::::::::::::::::.:::::::::::::: 
CTGGGCCCCCCTGCAGGACCTGGTCATCAGA---CTGGCCAAGTCTCCTTCAGCCAGAGCCCAGGAAGTGGCTTTCCAGCTGGCCCAGAATTGGATCCGC
--W--A--P--L--Q--D--L--V--I--R-----L--A--K--S--P--S--A--R--A--Q--E--V--A--F--Q--L--A--Q--N--W--I--R-

--------------------------------------------><----------------------------------------------------><
-T--N--F--D--V--Y--S--Q--K--S--A--M--Y--E--K--Y--D--V--S--N--G--G--Q--P--G--G--G--G--E--Y--E--V--Q--
ACCAATTTTGATGTCTACTCGCAGAAGTCAGCCATGTATGAGAAGTATGACGTCAGCAACGGTGGACAGCCCGGTGGGGGAGGAGAATATGAAGTTCAGG
:::::.::::::::::::::  .::.::::::::::::.::::::::::::.::::::::::::::::::: ::::: :::::.::.:::::::::::::
ACCAACTTTGATGTCTACTCCAGGAGGTCAGCCATGTACGAGAAGTATGACATCAGCAACGGTGGACAGCCGGGTGGTGGAGGGGAGTATGAAGTTCAGG
-T--N--F--D--V--Y--S--R--R--S--A--M--Y--E--K--Y--D--I--S--N--G--G--Q--P--G--G--G--G--E--Y--E--V--Q--

----------------------------------------------------------------------------------------------------
E--G--F--G--W--T--N--G--V--V--L--M--L--L--D--R--Y--G--D--R--L--T--S--G--P--K--L--P--F--L--E--P--H--C
AGGGATTTGGCTGGACGAATGGCGTGGTCCTGATGCTGCTGGACCGCTATGGTGACCGGCTGACCTCAGGGCCCAAGCTGCCTTTCCTGGAGCCCCACTG
::::.::::::::::: ::::: :::::::::::::: ::::::::::::::::::::::::: ::::::: :: :: .. .:::::::::::::: :::
AGGGGTTTGGCTGGACCAATGGAGTGGTCCTGATGCTCCTGGACCGCTATGGTGACCGGCTGAGCTCAGGGACCCAGACAGTTTTCCTGGAGCCCCCCTG
E--G--F--G--W--T--N--G--V--V--L--M--L--L--D--R--Y--G--D--R--L--S--S--G--T--Q--T--V--F--L--E--P--P--C

---><------------------------------------------->
--L--A--T--L--L--P--S--L--L--L--S--L--L--P--W--*-
CCTGGCCACCCTTCTGCCCAGCCTCCTGCTAAGCCTCCTGCCATGGTGA
.                                                
T------------------------------------------------
-------------------------------------------------

Pig Consensus Sequence

>BGISUST0000884791
------------------------------------------------------------------------------------------CAGATTTACT
GCCACGGGGAGCTCCTGCGCCAGGTTCAGATGGCCAGGCTCTACCAGGATGATNAGCAATTTGTGGATATGCCATTGTCCGTAGCTCCA-----------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------GACTCCTACTGGGTGATGGAGGGTCTGCTCCTGTCCGAGATGCCAGTGACGGTGAAGGGCATGCTGCAGAACTTC
CTGGACTTGGTG------TACGGACACGTCCCCAACGGGGCCCGCGTGTACTACCTGCAGCGGAGCCAGCCCCCGCTCCTGAGCCTCATGATGGAGCGCT
ACGTGACTCAGGCCAATGACACC------------GACAACCTGGAGACCCTGGCCTTGGAGTTGGACTTTTGGACCAAGAACAGGAGCATCTCTGTGAG
CTCTGGGGGAAAGAGCTAC---------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----AATGACTCCCAAGCTGAGAAGTACAGAAATTTGCGAGCACAGCGCATGGCCGCCATGAAGGACATCCTGTGGGATGAGGAGAAAGGTGCCTGGTTT
GACTATGACCTTGAGAACGGAAAGAAGAACCTTGAGTTTTACCCATCCAACCTCGCTCCGCTCTGGGCTGGCTGCTTCTCTGACCCAGGCGACGTGGACA
AGGCTCTGAAATACCTGGAGGACAGCCAGATCCTCACCTACCACTACGGAATCCCGACCTCTCTCCGGAAGACAGGCCAGCAGTGGGACTTCCCCAACGC
CTGGGCCCCCCTGCAGGACCTGGTCATCAGA---CTGGCCAAGTCTCCTTCAGCCAGAGCCCAGGAAGTGGCTTTCCAGCTGGCCCAGAATTGGATCCGC
ACCAACTTTGATGTCTACTCCAGGAGGTCAGCCATGTACGAGAAGTATGACATCAGCAACGGTGGACAGCCGGGTGGTGGAGGGGAGTATGAAGTTCAGG
AGGGGTTTGGCTGGACCAATGGAGTGGTCCTGATGCTCCTGGACCGCTATGGTGACCGGCTGAGCTCAGGGACCCAGACAGTTTTCCTGGAGCCCCCCTG
T------------------------------------------------


>BGISUSP0000884791
------------------------------QIYCHGELLRQVQMARLYQDD-QFVDMPLSVAP-------------------------------------
---------------------------------------------------------------------------DSYWVMEGLLLSEMPVTVKGMLQNF
LDLV--YGHVPNGARVYYLQRSQPPLLSLMMERYVTQANDT----DNLETLALELDFWTKNRSISVSSGGKSY---------------------------
--------------------------------------------------------------------NDSQAEKYRNLRAQRMAAMKDILWDEEKGAWF
DYDLENGKKNLEFYPSNLAPLWAGCFSDPGDVDKALKYLEDSQILTYHYGIPTSLRKTGQQWDFPNAWAPLQDLVIR-LAKSPSARAQEVAFQLAQNWIR
TNFDVYSRRSAMYEKYDISNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLSSGTQTVFLEPPC----------------