Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000110395 (click for geneview)
Transcript ID ENST00000264033(link to ensembl)
Symbol CBL
Localtion Chromosome:11:118582199:118675922:1 band: 11q23.3
Description CBL E3 ubiquitin protein ligase (EC 6.3.2.-) (Signal transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto- oncogene) (RING finger protein 55). [Source:Uniprot/SWISSPROT;Acc:P22681]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--G--N--V--K--K--S--S--G--A--G--G--G--S--G--S--G--G--S--G--S--G--G--L--I--G--L--M--K--D--A--F--
ATGGCCGGCAACGTGAAGAAGAGCTCTGGGGCCGGGGGCGGCAGCGGCTCCGGGGGCTCGGGTTCGGGTGGCCTGATTGGGCTCATGAAGGACGCCTTCC
:::::::::::.:::::.:: :::::::::::::::::::::.::::::::::.:: :::::.:::::.::::::::.::::::::::::::::::::::
ATGGCCGGCAATGTGAAAAATAGCTCTGGGGCCGGGGGCGGCGGCGGCTCCGGAGGATCGGGCTCGGGCGGCCTGATCGGGCTCATGAAGGACGCCTTCC
-M--A--G--N--V--K--N--S--S--G--A--G--G--G--G--G--S--G--G--S--G--S--G--G--L--I--G--L--M--K--D--A--F--

----------------------------------------------------------------------------------------------><----
Q--P--H--H--H--H--H--H--H--L--S--P--H--P--P--G--T--V--D--K--K--M--V--E--K--C--W--K--L--M--D--K--V--V
AGCCGCACCACCACCACCACCACCACCTCAGCCCCCACCCGCCGGGGACGGTGGACAAGAAGATGGTGGAGAAGTGCTGGAAGCTCATGGACAAGGTGGT
:::::   :::::::::::::::::::::::::::::::::::.::::: ::::::::::::::::::::::::::::::::::::::::::::::::::
AGCCG---CACCACCACCACCACCACCTCAGCCCCCACCCGCCAGGGACCGTGGACAAGAAGATGGTGGAGAAGTGCTGGAAGCTCATGGACAAGGTGGT
Q--P-----H--H--H--H--H--H--L--S--P--H--P--P--G--T--V--D--K--K--M--V--E--K--C--W--K--L--M--D--K--V--V

----------------------------------------------------------------------------------------------------
--R--L--C--Q--N--P--K--L--A--L--K--N--S--P--P--Y--I--L--D--L--L--P--D--T--Y--Q--H--L--R--T--I--L--S-
GCGGTTGTGTCAGAACCCAAAGCTGGCGCTAAAGAATAGCCCACCTTATATCTTAGACCTGCTACCAGATACCTACCAGCATCTCCGTACTATCTTGTCA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::::::::::::
GCGGTTGTGTCAGAACCCAAAGCTGGCGCTAAAGAATAGCCCACCTTATATCTTAGACCTGCTGCCAGATACCTACCAGCATCTCCGCACTATCTTGTCA
--R--L--C--Q--N--P--K--L--A--L--K--N--S--P--P--Y--I--L--D--L--L--P--D--T--Y--Q--H--L--R--T--I--L--S-

----------------------------------------------------------------------------------------------------
-R--Y--E--G--K--M--E--T--L--G--E--N--E--Y--F--R--V--F--M--E--N--L--M--K--K--T--K--Q--T--I--S--L--F--
AGATATGAGGGGAAGATGGAGACACTTGGAGAAAATGAGTATTTTAGGGTGTTTATGGAGAATTTGATGAAGAAAACTAAGCAAACCATAAGCCTCTTCA
:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::
AGATATGAGGGGAAGATGGAGACACTTGGAGAAAATGAGTATTTTAGGGTGTTCATGGAGAATTTGATGAAGAAAACTAAGCAGACCATAAGCCTCTTCA
-R--Y--E--G--K--M--E--T--L--G--E--N--E--Y--F--R--V--F--M--E--N--L--M--K--K--T--K--Q--T--I--S--L--F--

------------------------------------------><--------------------------------------------------------
K--E--G--K--E--R--M--Y--E--E--N--S--Q--P--R--R--N--L--T--K--L--S--L--I--F--S--H--M--L--A--E--L--K--G
AGGAGGGAAAAGAAAGAATGTATGAGGAGAATTCTCAGCCTAGGCGAAACCTAACCAAACTGTCCCTCATCTTCAGCCACATGCTGGCAGAACTAAAAGG
:.:::::.:::::::::::::::::::::::::::::::::   ::::::::::::::::::::::: ::::::::::::::::::::::::::.:::::
AAGAGGGGAAAGAAAGAATGTATGAGGAGAATTCTCAGCCT---CGAAACCTAACCAAACTGTCCCTAATCTTCAGCCACATGCTGGCAGAACTGAAAGG
K--E--G--K--E--R--M--Y--E--E--N--S--Q--P-----R--N--L--T--K--L--S--L--I--F--S--H--M--L--A--E--L--K--G

-----------------------------------------------------------------------------------------><---------
--I--F--P--S--G--L--F--Q--G--D--T--F--R--I--T--K--A--D--A--A--E--F--W--R--K--A--F--G--E--K--T--I--V-
AATCTTTCCAAGTGGACTCTTTCAGGGAGACACATTTCGGATTACTAAAGCAGATGCTGCGGAATTTTGGAGAAAAGCTTTTGGGGAAAAGACAATAGTC
::::::::::::::::::::::::.:::::::::::::::::::::::::::::.:::::.::.::::::::.:::::::::::::::            
AATCTTTCCAAGTGGACTCTTTCAAGGAGACACATTTCGGATTACTAAAGCAGACGCTGCAGAGTTTTGGAGGAAAGCTTTTGGGGAA------------
--I--F--P--S--G--L--F--Q--G--D--T--F--R--I--T--K--A--D--A--A--E--F--W--R--K--A--F--G--E-------------

----------------------------------------------------------------------------------------------------
-P--W--K--S--F--R--Q--A--L--H--E--V--H--P--I--S--S--G--L--E--A--M--A--L--K--S--T--I--D--L--T--C--N--
CCTTGGAAGAGCTTTCGACAGGCTCTACATGAAGTGCATCCCATCAGTTCTGGGCTGGAGGCCATGGCTCTGAAATCCACTATTGATCTGACCTGCAATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
D--Y--I--S--V--F--E--F--D--I--F--T--R--L--F--Q--P--W--S--S--L--L--R--N--W--N--S--L--A--V--T--H--P--G
ATTATATTTCGGTTTTTGAATTTGACATCTTTACCCGACTCTTTCAGCCCTGGTCCTCTTTGCTCAGGAATTGGAACAGCCTTGCTGTAACTCATCCTGG
                                                           ::::::::.::.:::::.::.::::::::::::::::::::
-----------------------------------------------------------TTGCTCAGAAACTGGAATAGTCTTGCTGTAACTCATCCTGG
------------------------------------------------------------L--L--R--N--W--N--S--L--A--V--T--H--P--G

--------------------------------------------------------------------><------------------------------
--Y--M--A--F--L--T--Y--D--E--V--K--A--R--L--Q--K--F--I--H--K--P--G--S--Y--I--F--R--L--S--C--T--R--L-
CTACATGGCTTTTTTGACGTATGACGAAGTGAAAGCTCGGCTCCAGAAATTCATTCACAAACCTGGCAGTTATATCTTCCGGCTGAGCTGTACTCGTCTG
.:::::::::::..::::.::.::.::.:::::::::::::::::::::::::::::::::::::::   ::.::.::.:::::.:::::::::::::::
TTACATGGCTTTCCTGACATACGATGAGGTGAAAGCTCGGCTCCAGAAATTCATTCACAAACCTGGC---TACATTTTTCGGCTAAGCTGTACTCGTCTG
--Y--M--A--F--L--T--Y--D--E--V--K--A--R--L--Q--K--F--I--H--K--P--G-----Y--I--F--R--L--S--C--T--R--L-

----------------------------------------------------------------------------------------------------
-G--Q--W--A--I--G--Y--V--T--A--D--G--N--I--L--Q--T--I--P--H--N--K--P--L--F--Q--A--L--I--D--G--F--R--
GGTCAGTGGGCTATTGGGTATGTTACTGCTGATGGGAACATTCTCCAGACAATCCCTCACAATAAACCTCTCTTCCAAGCACTGATTGATGGCTTCAGGG
:::::::::::.::.::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGTCAGTGGGCCATCGGGTATGTCACTGCTGATGGGAACATTCTCCAGACAATCCCTCACAATAAACCTCTCTTCCAAGCACTGATTGATGGCTTCAGGG
-G--Q--W--A--I--G--Y--V--T--A--D--G--N--I--L--Q--T--I--P--H--N--K--P--L--F--Q--A--L--I--D--G--F--R--

------><--------------------------------------------------------------------------------------><----
E--G--F--Y--L--F--P--D--G--R--N--Q--N--P--D--L--T--G--L--C--E--P--T--P--Q--D--H--I--K--V--T--Q--E--Q
AAGGCTTCTATTTGTTTCCTGATGGACGAAATCAGAATCCTGATCTGACTGGCTTATGTGAACCAACTCCCCAAGACCATATCAAAGTGACCCAGGAACA
:::::   ::::::::::::::::::::.::::::::::::::.::::: :::::::::::::::::::: ::::::::.::::::::::::::::::::
AAGGC---TATTTGTTTCCTGATGGACGGAATCAGAATCCTGACCTGACAGGCTTATGTGAACCAACTCCACAAGACCACATCAAAGTGACCCAGGAACA
E--G-----Y--L--F--P--D--G--R--N--Q--N--P--D--L--T--G--L--C--E--P--T--P--Q--D--H--I--K--V--T--Q--E--Q

----------------------------------------------------------------------------------------------------
--Y--E--L--Y--C--E--M--G--S--T--F--Q--L--C--K--I--C--A--E--N--D--K--D--V--K--I--E--P--C--G--H--L--M-
ATATGAATTATACTGTGAGATGGGCTCCACATTCCAACTATGTAAAATATGTGCTGAAAATGATAAGGATGTAAAGATTGAGCCCTGTGGACACCTCATG
:::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::
ATATGAATTATACTGTGAGATGGGCTCCACATTCCAACTGTGTAAAATATGTGCTGAAAATGATAAAGATGTGAAGATTGAGCCCTGTGGACACCTCATG
--Y--E--L--Y--C--E--M--G--S--T--F--Q--L--C--K--I--C--A--E--N--D--K--D--V--K--I--E--P--C--G--H--L--M-

--------------------------><------------------------------------------------------------------------
-C--T--S--C--L--T--S--W--Q--E--S--E--G--Q--G--C--P--F--C--R--C--E--I--K--G--T--E--P--I--V--V--D--P--
TGCACATCCTGTCTTACATCCTGGCAGGAATCAGAAGGTCAGGGCTGTCCTTTCTGCCGATGTGAAATTAAAGGTACTGAACCCATCGTGGTAGATCCGT
:::::::::::::: :::::.:::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::::.:::::.:::::::
TGCACATCCTGTCTAACATCTTGGCAGGAATCAGAAGGCCAGGGCTGTCCTTTCTGCCGATGTGAAATTAAAGGTACTGAGCCCATTGTGGTGGATCCGT
-C--T--S--C--L--T--S--W--Q--E--S--E--G--Q--G--C--P--F--C--R--C--E--I--K--G--T--E--P--I--V--V--D--P--

----------------------------------------------------------------------------------------------------
F--D--P--R--G--S--G--S--L--L--R--Q--G--A--E--G--A--P--S--P--N--Y--D--D--D--D--D--E--R--A--D--D--T--L
TTGATCCTAGAGGGAGTGGCAGCCTGTTGAGGCAAGGAGCAGAGGGAGCTCCCTCCCCAAATTATGATGATGATGATGATGAACGAGCTGATGATACTCT
:::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::
TTGATCCTAGAGGAAGTGGCAGCCTGTTGAGGCAAGGAGCGGAGGGAGCTCCCTCCCCAAATTATGATGATGATGATGATGAACGAGCTGATGATTCTCT
F--D--P--R--G--S--G--S--L--L--R--Q--G--A--E--G--A--P--S--P--N--Y--D--D--D--D--D--E--R--A--D--D--S--L

------------------------------><--------------------------------------------------------------------
--F--M--M--K--E--L--A--G--A--K--V--E--R--P--P--S--P--F--S--M--A--P--Q--A--S--L--P--P--V--P--P--R--L-
CTTCATGATGAAGGAATTGGCTGGTGCCAAGGTGGAACGGCCGCCTTCTCCATTCTCCATGGCCCCACAAGCTTCCCTTCCCCCGGTGCCACCACGACTT
:::::::::::::::::::::: :::::::::::::.::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::.:::
CTTCATGATGAAGGAATTGGCTTGTGCCAAGGTGGAGCGGCCTCCTTCTCCATTCTCCATGGCCCCACAAGCTTCCCTTCCCCCGGTGCCACCACGGCTT
--F--M--M--K--E--L--A--C--A--K--V--E--R--P--P--S--P--F--S--M--A--P--Q--A--S--L--P--P--V--P--P--R--L-

--------------------------------------------------------------><------------------------------------
-D--L--L--P--Q--R--V--C--V--P--S--S--A--S--A--L--G--T--A--S--K--A--A--S--G--S--L--H--K--D--K--P--L--
GACCTTCTGCCGCAGCGAGTATGTGTTCCCTCAAGTGCTTCTGCTCTTGGAACTGCTTCTAAGGCTGCTTCTGGCTCCCTTCATAAAGACAAACCATTGC
:::::::::: .::::::.::: :.::::.::.:::.::::.: :::::::::::::::::::::: :::::::::::::::::::.:::::::::::.:
GACCTTCTGCAACAGCGAATATCTATTCCTTCGAGTACTTCCGGTCTTGGAACTGCTTCTAAGGCTCCTTCTGGCTCCCTTCATAAGGACAAACCATTAC
-D--L--L--Q--Q--R--I--S--I--P--S--S--T--S--G--L--G--T--A--S--K--A--P--S--G--S--L--H--K--D--K--P--L--

----------------------------------------------------------------------------------------------------
P--V--P--P--T--L--R--D--L--P--P--P--P--P--P--D--R--P--Y--S--V--G--A--E--S--R--P--Q--R--R--P--L--P--C
CAGTACCTCCCACACTTCGAGATCTTCCACCACCACCGCCTCCAGACCGGCCATATTCTGTTGGAGCAGAATCCCGACCTCAAAGACGCCCCTTGCCTTG
::.::::::: :: :::::::::::.::::::::::: :::::::::::::::::::::: ::::.::::. ::::.:::::::::::::::::::::::
CAATACCTCCGACTCTTCGAGATCTCCCACCACCACCCCCTCCAGACCGGCCATATTCTGGTGGAACAGAGACCCGGCCTCAAAGACGCCCCTTGCCTTG
P--I--P--P--T--L--R--D--L--P--P--P--P--P--P--D--R--P--Y--S--G--G--T--E--T--R--P--Q--R--R--P--L--P--C

----------------------------------------------------------------------------------------------------
--T--P--G--D--C--P--S--R--D--K--L--P--P--V--P--S--S--R--L--G--D-----S--W--L--P--R--P--I--P--K--V--P-
TACACCAGGCGACTGTCCCTCCAGAGACAAACTGCCCCCTGTCCCCTCTAGCCGCCTTGGAGAC---TCATGGCTGCCCCGGCCAATCCCCAAAGTACCA
:::::: :: :::::::: :::::::::::::::::::::::::::::::::::. :::::::    :: ::::::::.:::::::::::::::::::::
TACACCCGGAGACTGTCCATCCAGAGACAAACTGCCCCCTGTCCCCTCTAGCCGTGTTGGAGAAGCATCTTGGCTGCCTCGGCCAATCCCCAAAGTACCA
--T--P--G--D--C--P--S--R--D--K--L--P--P--V--P--S--S--R--V--G--E--A--S--W--L--P--R--P--I--P--K--V--P-

----------------------------------------------------------------------------------------------------
-V--S--A--P--S--S--S--D--P--W--T--G--R--E--L--T--N--R--H--S--L--P--F--S--L--P--S--Q--M--E--P--R--P--
GTATCTGCCCCAAGTTCCAGTGATCCCTGGACAGGAAGAGAATTAACCAACCGGCACTCACTTCCATTTTCATTGCCCTCACAAATGGAGCCCAGACCAG
::: .::::::::...:..:.::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::: : :
GTAGTTGCCCCAAACCCTGGCGACCCCTGGACAGGGAGAGAATTAACCAACCGGCACTCACTTCCATTTTCATTGCCCTCACAAATGGAACCCAGAACCG
-V--V--A--P--N--P--G--D--P--W--T--G--R--E--L--T--N--R--H--S--L--P--F--S--L--P--S--Q--M--E--P--R--T--

-------------------------------------------><-------------------------------------------------------
D--V--P--R--L--G--S--T--F--S--L--D--T--S--M--S--M--N--S--S--P--L--V--G--P--E--C--D--H--P--K--I--K--P
ATGTGCCTAGGCTCGGAAGCACGTTCAGTCTGGATACCTCCATGAGTATGAATAGCAGCCCATTAGTAGGTCCAGAGTGTGACCACCCCAAAATCAAACC
:::::::::::::.::::::.:.:::::.:::::::::::..:::.::::::::::::::::::::.::::::::::::::: ::.::::::::::::::
ATGTGCCTAGGCTTGGAAGCGCATTCAGCCTGGATACCTCTGTGAATATGAATAGCAGCCCATTAGCAGGTCCAGAGTGTGAGCATCCCAAAATCAAACC
D--V--P--R--L--G--S--A--F--S--L--D--T--S--V--N--M--N--S--S--P--L--A--G--P--E--C--E--H--P--K--I--K--P

--------------------------------------><------------------------------------------------------------
--S--S--S--A--N--A--I--Y--S--L--A--A--R--P--L--P--V--P--K--L--P--P--G--E--Q--C--E--G--E--E--D--T--E-
TTCCTCATCTGCCAATGCCATTTATTCTCTGGCTGCCAGACCTCTTCCTGTGCCAAAACTGCCACCTGGGGAGCAATGTGAGGGTGAAGAGGACACAGAG
 ::: ::::::::::::::::::::::::::::::::                                                               
ATCCGCATCTGCCAATGCCATTTATTCTCTGGCTGCC---------------------------------------------------------------
--S--A--S--A--N--A--I--Y--S--L--A--A----------------------------------------------------------------

-------------------------------------------------------><-------------------------------------------
-Y--M--T--P--S--S--R--P--L--R--P--L--D--T--S--Q--S--S--R--A--C--D--C--D--Q--Q--I--D--S--C--T--Y--E--
TACATGACTCCCTCTTCCAGGCCTCTACGGCCTTTGGATACATCCCAGAGTTCACGAGCATGTGATTGCGACCAGCAGATTGATAGCTGTACGTATGAAG
                                                         ::: :::::::.:::: ::::::::::::::::::.:::::::
---------------------------------------------------------GCAAGTGATTGTGACCTGCAGATTGATAGCTGTACATATGAAG
----------------------------------------------------------A--S--D--C--D--L--Q--I--D--S--C--T--Y--E--

--------------------------------------------------------><------------------------------------------
A--M--Y--N--I--Q--S--Q--A-----P--S--I--T--E--S--S--T--F--G--E--G--N--L--A--A--A--H--A--N--T--G--P--E
CAATGTATAATATTCAGTCCCAGGCG---CCATCTATCACCGAGAGCAGCACCTTTGGTGAAGGGAATTTGGCCGCAGCCCATGCCAACACTGGTCCCGA
:::::::::::::::: :::::::::   ::::::.:::: :::::..:.::.:::   :::::::::::::::.:::::::::::::::::::.::.::
CAATGTATAATATTCATTCCCAGGCGGCACCATCTGTCACAGAGAGTGGTACTTTT---GAAGGGAATTTGGCCACAGCCCATGCCAACACTGGCCCTGA
A--M--Y--N--I--H--S--Q--A--A--P--S--V--T--E--S--G--T--F-----E--G--N--L--A--T--A--H--A--N--T--G--P--E

----------------------------------------------------------------------------------------------------
--E--S--E--N--E--D--D--G--Y--D--V--P--K--P--P--V--P--A--V--L--A--R--R--T--L--S--D--I--S--N--A--S--S-
GGAGTCAGAAAATGAGGATGATGGGTATGATGTCCCAAAGCCACCTGTGCCGGCCGTGCTGGCCCGCCGAACTCTCTCAGATATCTCTAATGCCAGCTCC
:::.:: :::::.::.:: ::::: :::::::: :: ::::::::::::                                                   
GGAATCCGAAAACGAAGAGGATGGTTATGATGTGCCCAAGCCACCTGTG---------------------------------------------------
--E--S--E--N--E--E--D--G--Y--D--V--P--K--P--P--V----------------------------------------------------

---------------------------------------><-----------------------------------------------------------
-S--F--G--W--L--S--L--D--G--D--P--T--T--N--V--T--E--G--S--Q--V--P--E--R--P--P--K--P--F--P--R--R--I--
TCCTTTGGCTGGTTGTCTCTGGATGGTGATCCTACAACAAATGTCACTGAAGGTTCCCAAGTTCCCGAGAGGCCTCCAAAACCATTCCCGCGGAGAATCA
                                             :::::.::::::::::::::.::::::::::: ::::::::::: ::::::::::
---------------------------------------------ACTGAGGGTTCCCAAGTTCCTGAGAGGCCTCCTAAACCATTCCCTCGGAGAATCA
----------------------------------------------T--E--G--S--Q--V--P--E--R--P--P--K--P--F--P--R--R--I--

----------------------------------------------------------------------------------------------------
N--S--E--R--K--A--G--S--C--Q--Q--G--S--G--P--A--A--S--A--A--T--A--S--P--Q--L--S--S--E--I--E--N--L--M
ACTCTGAACGGAAAGCTGGCAGCTGTCAGCAAGGTAGTGGTCCTGCCGCCTCTGCTGCCACCGCCTCACCTCAGCTCTCCAGTGAGATCGAGAACCTCAT
::::::::::.::::::::.:::::::::::..:.:::: .   ::.::: :.::.:::.:::::::::: ::::: ::::::::::::::::.::::::
ACTCTGAACGAAAAGCTGGTAGCTGTCAGCAGAGCAGTGCC---GCTGCCGCCGCCGCCGCCGCCTCACCGCAGCTATCCAGTGAGATCGAGAGCCTCAT
N--S--E--R--K--A--G--S--C--Q--Q--S--S--A-----A--A--A--A--A--A--A--S--P--Q--L--S--S--E--I--E--S--L--M

----------------------------------------------------------------------------------------------------
--S--Q--G--Y--S--Y--Q--D--I--Q--K--A--L--V--I--A--Q--N--N--I--E--M--A--K--N--I--L--R--E--F--V--S--I-
GAGTCAGGGGTACTCCTACCAGGACATCCAGAAAGCTTTGGTCATTGCCCAGAACAACATCGAGATGGCCAAAAACATCCTCCGGGAATTTGTTTCCATT
:::::::::::::::::::::::::::.:::::.::::::::::::::::: ::::::::.::.:::::::::::.::::::::::::::::::::::::
GAGTCAGGGGTACTCCTACCAGGACATTCAGAAGGCTTTGGTCATTGCCCACAACAACATTGAAATGGCCAAAAATATCCTCCGGGAATTTGTTTCCATT
--S--Q--G--Y--S--Y--Q--D--I--Q--K--A--L--V--I--A--H--N--N--I--E--M--A--K--N--I--L--R--E--F--V--S--I-

-------------------------->
-S--S--P--A--H--V--A--T--*-
TCTTCTCCTGCCCATGTAGCTACCTAG
::.:::::::::::::::::.::::::
TCCTCTCCTGCCCATGTAGCCACCTAG
-S--S--P--A--H--V--A--T--*-

Pig Consensus Sequence

>BGISUST0000887003
ATGGCCGGCAATGTGAAAAATAGCTCTGGGGCCGGGGGCGGCGGCGGCTCCGGAGGATCGGGCTCGGGCGGCCTGATCGGGCTCATGAAGGACGCCTTCC
AGCCGCACCACCACCACCACCACCTCAGCCCCCACCCGCCAGGGACCGTGGACAAGAAGATGGTGGAGAAGTGCTGGAAGCTCATGGACAAGGTGGTGCG
GTTGTGTCAGAACCCAAAGCTGGCGCTAAAGAATAGCCCACCTTATATCTTAGACCTGCTGCCAGATACCTACCAGCATCTCCGCACTATCTTGTCAAGA
TATGAGGGGAAGATGGAGACACTTGGAGAAAATGAGTATTTTAGGGTGTTCATGGAGAATTTGATGAAGAAAACTAAGCAGACCATAAGCCTCTTCAAAG
AGGGGAAAGAAAGAATGTATGAGGAGAATTCTCAGCCT---CGAAACCTAACCAAACTGTCCCTAATCTTCAGCCACATGCTGGCAGAACTGAAAGGAAT
CTTTCCAAGTGGACTCTTTCAAGGAGACACATTTCGGATTACTAAAGCAGACGCTGCAGAGTTTTGGAGGAAAGCTTTTGGGGAA---------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------TTGCTCAGAAACTGGAATAGTCTTGCTGTAACTCATCCTGGTTA
CATGGCTTTCCTGACATACGATGAGGTGAAAGCTCGGCTCCAGAAATTCATTCACAAACCTGGC---TACATTTTTCGGCTAAGCTGTACTCGTCTGGGT
CAGTGGGCCATCGGGTATGTCACTGCTGATGGGAACATTCTCCAGACAATCCCTCACAATAAACCTCTCTTCCAAGCACTGATTGATGGCTTCAGGGAAG
GC---TATTTGTTTCCTGATGGACGGAATCAGAATCCTGACCTGACAGGCTTATGTGAACCAACTCCACAAGACCACATCAAAGTGACCCAGGAACAATA
TGAATTATACTGTGAGATGGGCTCCACATTCCAACTGTGTAAAATATGTGCTGAAAATGATAAAGATGTGAAGATTGAGCCCTGTGGACACCTCATGTGC
ACATCCTGTCTAACATCTTGGCAGGAATCAGAAGGCCAGGGCTGTCCTTTCTGCCGATGTGAAATTAAAGGTACTGAGCCCATTGTGGTGGATCCGTTTG
ATCCTAGAGGAAGTGGCAGCCTGTTGAGGCAAGGAGCGGAGGGAGCTCCCTCCCCAAATTATGATGATGATGATGATGAACGAGCTGATGATTCTCTCTT
CATGATGAAGGAATTGGCTTGTGCCAAGGTGGAGCGGCCTCCTTCTCCATTCTCCATGGCCCCACAAGCTTCCCTTCCCCCGGTGCCACCACGGCTTGAC
CTTCTGCAACAGCGAATATCTATTCCTTCGAGTACTTCCGGTCTTGGAACTGCTTCTAAGGCTCCTTCTGGCTCCCTTCATAAGGACAAACCATTACCAA
TACCTCCGACTCTTCGAGATCTCCCACCACCACCCCCTCCAGACCGGCCATATTCTGGTGGAACAGAGACCCGGCCTCAAAGACGCCCCTTGCCTTGTAC
ACCCGGAGACTGTCCATCCAGAGACAAACTGCCCCCTGTCCCCTCTAGCCGTGTTGGAGAAGCATCTTGGCTGCCTCGGCCAATCCCCAAAGTACCAGTA
GTTGCCCCAAACCCTGGCGACCCCTGGACAGGGAGAGAATTAACCAACCGGCACTCACTTCCATTTTCATTGCCCTCACAAATGGAACCCAGAACCGATG
TGCCTAGGCTTGGAAGCGCATTCAGCCTGGATACCTCTAATATGAATAGCAGCCCATTAGCAGGTCCAGAGTGTGAGCATCCCAAAATCAAACCATCCGC
ATCTGCCAATGCCATTTATTCTCTGGCTGCC---------------------------------------------------------------------
---------------------------------------------------GCAAGTGATTGTGACCTGCAGATTGATAGCTGTACATATGAAGCAATGT
ATAATATTCATTCCCAGGCGGCACCATCTGTCACAGAGAGTGGTACT---GAAGGGAATTTGGCCACAGCCCATGCCAACACTGGCCCTGAGGAATCCGA
AAACGAAGAGGATGGTTATGATGTGCCCAAGCCACCTGTG------------------------------------------------------------
------------------------------------ACTGAGGGTTCCCAAGTTCCTGAGAGGCCTCCTAAACCATTCCCTCGGAGAATCAACTCTGAAC
GAAAAGCTGGTAGCTGTCAGCAGAGCAGTGCCGCTGCCGCCGCCGCCGCCGCCTCACCGCAGCTATCCAGTGAGATCGAGAGCCTCATGAGTCAGGGGTA
CTCCTACCAGGACATTCAGAAGGCTTTGGTCATTGCCCACAACAACATTGAAATGGCCAAAAATATCCTCCGGGAATTTGTTTCCATTTCCTCTCCTGCC
CATGTAGCCACCTAG


>BGISUSP0000887003
MAGNVKNSSGAGGGGGSGGSGSGGLIGLMKDAFQPHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSR
YEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQP-RNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGE-----
----------------------------------------------------LLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPG-YIFRLSCTRLG
QWAIGYVTADGNILQTIPHNKPLFQALIDGFREG-YLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMC
TSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELACAKVERPPSPFSMAPQASLPPVPPRLD
LLQQRISIPSSTSGLGTASKAPSGSLHKDKPLPIPPTLRDLPPPPPPDRPYSGGTETRPQRRPLPCTPGDCPSRDKLPPVPSSRVGEASWLPRPIPKVPV
VAPNPGDPWTGRELTNRHSLPFSLPSQMEPRTDVPRLGSAFSLDTSNMNSSPLAGPECEHPKIKPSASANAIYSLAA-----------------------
-----------------ASDCDLQIDSCTYEAMYNIHSQAAPSVTESGT-EGNLATAHANTGPEESENEEDGYDVPKPPV--------------------
------------TEGSQVPERPPKPFPRRINSERKAGSCQQSSAAAAAAAASPQLSSEIESLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPA
HVAT*