Sequences
EST Library Info
nca5Newborn 115 days, cartillage
nco1Newborn 115 days, colon
ova1Ovary
ret1Retina
Clusters
Oligos
SNPs

Gene ID ENSG00000121957 (click for geneview)
Transcript ID ENST00000264126(link to ensembl)
Symbol GPSM2
Localtion Chromosome:1:109131869:109185060:1 band: 1p13.3
Description G-protein signalling modulator 2 (Mosaic protein LGN). [Source:Uniprot/SWISSPROT;Acc:P81274]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------><----------------------------------------------------------------
-M--R--E--D--H--S--F--H--V--R--Y--R--M--E--A--S--C--L--E--L--A--L--E--G--E--R--L--C--K--S--G--D--C--
ATGAGAGAAGACCATTCTTTTCATGTTCGTTACAGAATGGAAGCTTCTTGCCTAGAGCTGGCCTTGGAAGGGGAACGTCTATGTAAATCAGGAGACTGCC
                                    ::::::::::::::::::::.:::::::::::::::::.:::::.::.::::::::::::::::
------------------------------------ATGGAAGCTTCTTGCCTAGAACTGGCCTTGGAAGGGGAGCGTCTGTGCAAATCAGGAGACTGCC
-------------------------------------M--E--A--S--C--L--E--L--A--L--E--G--E--R--L--C--K--S--G--D--C--

----------------------------------------------------------------------------------------------------
R--A--G--V--S--F--F--E--A--A--V--Q--V--G--T--E--D--L--K--T--L--S--A--I--Y--S--Q--L--G--N--A--Y--F--Y
GCGCTGGCGTGTCATTCTTTGAAGCTGCAGTTCAAGTTGGAACTGAAGACCTAAAAACACTTAGCGCTATTTACAGCCAGTTGGGCAATGCTTATTTCTA
:.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::: :::::.:::::::::::::::.:::::::::::::::::::
GTGCTGGTGTGTCATTCTTTGAAGCTGCAGTTCAAGTTGGAACTGAAGACCTAAAAACCCTTAGTGCTATTTACAGCCAGCTGGGCAATGCTTATTTCTA
R--A--G--V--S--F--F--E--A--A--V--Q--V--G--T--E--D--L--K--T--L--S--A--I--Y--S--Q--L--G--N--A--Y--F--Y

--------------------------------------------------------><------------------------------------------
--L--H--D--Y--A--K--A--L--E--Y--H--H--H--D--L--T--L--A--R--T--I--G--D--Q--L--G--E--A--K--A--S--G--N-
TTTGCATGATTATGCCAAAGCATTAGAATATCACCATCATGATTTAACCCTTGCAAGGACTATTGGAGACCAGCTGGGGGAAGCGAAAGCTAGTGGTAAT
::::::::::::::::::::::::::::::.::.::::::::::::::.:::      :::::::::::::.:.:::::::::: :::::::::::.:::
TTTGCATGATTATGCCAAAGCATTAGAATACCATCATCATGATTTAACTCTT------ACTATTGGAGACCGGTTGGGGGAAGCCAAAGCTAGTGGCAAT
--L--H--D--Y--A--K--A--L--E--Y--H--H--H--D--L--T--L--------T--I--G--D--R--L--G--E--A--K--A--S--G--N-

--------------------------------------------------------------------------------------------><------
-L--G--N--T--L--K--V--L--G--N--F--D--E--A--I--V--C--C--Q--R--H--L--D--I--S--R--E--L--N--D--K--V--G--
CTGGGAAACACCTTAAAAGTTCTTGGGAATTTTGACGAAGCCATAGTTTGTTGTCAGCGACACCTAGATATTTCCAGAGAGCTTAATGACAAGGTGGGAG
:::::::::::::::::.:::::::::::::::::.::::: .:.::::::::::::::::::.::::::::::::::::::: :::::::::::.::::
CTGGGAAACACCTTAAAGGTTCTTGGGAATTTTGATGAAGCGGTGGTTTGTTGTCAGCGACACTTAGATATTTCCAGAGAGCTAAATGACAAGGTAGGAG
-L--G--N--T--L--K--V--L--G--N--F--D--E--A--V--V--C--C--Q--R--H--L--D--I--S--R--E--L--N--D--K--V--G--

----------------------------------------------------------------------------------------------------
E--A--R--A--L--Y--N--L--G--N--V--Y--H--A--K--G--K--S--F--G--C--P--G--P--Q--D--V--G--E--F--P--E--E--V
AAGCAAGAGCACTTTACAATCTTGGGAATGTGTATCATGCCAAAGGGAAAAGTTTTGGTTGCCCTGGTCCCCAGGATGTAGGAGAATTTCCAGAAGAAGT
:::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::.:::::::::::.:::::.:::::::: ::::::::::::::
AAGCAAGAGCACTTTACAATCTTGGAAATGTGTATCATGCCAAAGGGAAAAGCTTTGGCTGCCCTGGTCCTCAGGACGTAGGAGACTTTCCAGAAGAAGT
E--A--R--A--L--Y--N--L--G--N--V--Y--H--A--K--G--K--S--F--G--C--P--G--P--Q--D--V--G--D--F--P--E--E--V

-----------------------------------><---------------------------------------------------------------
--R--D--A--L--Q--A--A--V--D--F--Y--E--E--N--L--S--L--V--T--A--L--G--D--R--A--A--Q--G--R--A--F--G--N-
GAGAGATGCTCTGCAGGCAGCCGTGGATTTTTATGAGGAAAACCTATCATTAGTGACTGCTTTGGGTGACCGAGCGGCACAAGGACGTGCCTTTGGAAAT
 :::.:.:::::::::::::: ::::::: ::::   ::::::::::::.:.:::::::::::::::::::::::.:: :::::::::::::::::::::
CAGAAACGCTCTGCAGGCAGCAGTGGATTATTAT---GAAAACCTATCACTGGTGACTGCTTTGGGTGACCGAGCAGCCCAAGGACGTGCCTTTGGAAAT
--R--N--A--L--Q--A--A--V--D--Y--Y-----E--N--L--S--L--V--T--A--L--G--D--R--A--A--Q--G--R--A--F--G--N-

-----------------------------------------------------------><---------------------------------------
-L--G--N--T--H--Y--L--L--G--N--F--R--D--A--V--I--A--H--E--Q--R--L--L--I--A--K--E--F--G--D--K--A--A--
CTTGGAAACACACATTACCTCCTTGGCAACTTCAGGGATGCAGTTATAGCTCATGAGCAGCGTCTCCTTATTGCAAAAGAATTTGGAGATAAAGCAGCTG
::::::::::::::::::::::::::::::::: ::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::
CTTGGAAACACACATTACCTCCTTGGCAACTTCCGGGATGCAGTCATAGCTCATGAGCAGCGTCTCCTTATTGCAAAAGAATTTGGAGATAAAGCAGCTG
-L--G--N--T--H--Y--L--L--G--N--F--R--D--A--V--I--A--H--E--Q--R--L--L--I--A--K--E--F--G--D--K--A--A--

---------------------------------------------------------------------------><-----------------------
E--R--R--A--Y--S--N--L--G--N--A--Y--I--F--L--G--E--F--E--T--A--S--E--Y--Y--K--K--T--L--L--L--A--R--Q
AAAGAAGAGCATATAGCAACCTTGGAAATGCATATATATTTCTTGGTGAATTTGAAACTGCCTCGGAATACTACAAGAAGACACTACTGTTGGCCCGACA
:::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::   :::::::::::::::::.:::::
AAAGAAGAGCCTATAGCAACCTTGGAAATGCATATATATTTCTTGGTGAATTTGAAACTGCCTCTGAATACTAC---AAGACACTACTGTTGGCTCGACA
E--R--R--A--Y--S--N--L--G--N--A--Y--I--F--L--G--E--F--E--T--A--S--E--Y--Y-----K--T--L--L--L--A--R--Q

----------------------------------------------------------------------------------------------------
--L--K--D--R--A--V--E--A--Q--S--C--Y--S--L--G--N--T--Y--T--L--L--Q--D--Y--E--K--A--I--D--Y--H--L--K-
GCTTAAAGACCGAGCTGTAGAAGCACAGTCTTGTTACAGTCTTGGAAATACATATACTTTACTTCAAGACTATGAAAAGGCCATTGATTATCATCTGAAG
:::.:::::: ::::::::::::::::: :::::::.::::::::.::.:::.:::::::::::::.::::::::::::::::::::.::::::::::::
GCTCAAAGACAGAGCTGTAGAAGCACAGGCTTGTTATAGTCTTGGGAACACACATACTTTACTTCAGGACTATGAAAAGGCCATTGACTATCATCTGAAG
--L--K--D--R--A--V--E--A--Q--A--C--Y--S--L--G--N--T--H--T--L--L--Q--D--Y--E--K--A--I--D--Y--H--L--K-

-------------------------------><-------------------------------------------------------------------
-H--L--A--I--A--Q--E--L--N--D--R--I--G--E--G--R--A--C--W--S--L--G--N--A--Y--T--A--L--G--N--H--D--Q--
CACTTAGCAATTGCTCAAGAGCTGAATGATAGAATTGGTGAAGGAAGAGCATGTTGGAGCTTAGGAAATGCATACACAGCACTAGGAAATCATGATCAAG
:::::.:::::.::.::.:::::.::::::                                             ::::: :::::::::::::::::::
CACTTGGCAATCGCCCAGGAGCTAAATGAT---------------------------------------------ACAGCTCTAGGAAATCATGATCAAG
-H--L--A--I--A--Q--E--L--N--D-----------------------------------------------T--A--L--G--N--H--D--Q--

----------------------------------------><----------------------------------------------------------
A--M--H--F--A--E--K--H--L--E--I--S--R--E--V--G--D--K--S--G--E--L--T--A--R--L--N--L--S--D--L--Q--M--V
CAATGCATTTTGCTGAAAAGCACTTGGAAATTTCAAGAGAGGTTGGGGATAAAAGTGGTGAACTAACAGCACGACTTAATCTCTCAGACCTTCAAATGGT
::::::::::::: ::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: :::::::::::.:::::::::::
CAATGCATTTTGCAGAAAAGCACTTGGAAATTTCAAGAGAGGTTGGAGATAAAAGTGGTGAACTAACAGCACGACTGAATCTCTCAGATCTTCAAATGGT
A--M--H--F--A--E--K--H--L--E--I--S--R--E--V--G--D--K--S--G--E--L--T--A--R--L--N--L--S--D--L--Q--M--V

----------------------------------------------------------------------><----------------------------
--L--G--L--S--Y--S--T--N--N--S--I--M--S--E--N--T--E--I--D--S--S--L--N--G--V--R--P--K--L--G--R--R--H-
TCTTGGTCTGAGCTACAGCACAAATAACTCCATAATGTCTGAAAATACTGAAATTGATAGCAGTTTGAATGGTGTACGCCCCAAGTTGGGACGCCGGCAT
:::::::.::::::::::::::::.::.:: .:::::::::::::::.:::::::::::.::::::: ::   :.:::::::::::::::::::::.::.
TCTTGGTTTGAGCTACAGCACAAACAATTCAGTAATGTCTGAAAATATTGAAATTGATAACAGTTTGCAT---GCACGCCCCAAGTTGGGACGCCGACAC
--L--G--L--S--Y--S--T--N--N--S--V--M--S--E--N--I--E--I--D--N--S--L--H-----A--R--P--K--L--G--R--R--H-

-----------------------------------------><---------------------------------------------------------
-S--M--E--N--M--E--L--M--K--L--T--P--E--K--V--Q--N--W--N--S--E--I--L--A--K--Q--K--P--L--I--A--K--P--
AGTATGGAAAATATGGAACTTATGAAGTTAACACCAGAAAAGGTACAGAACTGGAACAGTGAAATTCTTGCTAAGCAAAAACCTCTTATTGCCAAACCTT
:::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::
AGTATGGAAAACATGGAACTTATGAAGTTAACACCAGAAAAGGTACAAAACTGGAACAGTGAAATTCTTGCTAAACAAAAACCTCTTATTGCCAAACCTT
-S--M--E--N--M--E--L--M--K--L--T--P--E--K--V--Q--N--W--N--S--E--I--L--A--K--Q--K--P--L--I--A--K--P--

----------------------------------------------------------------------------------------------------
S--A--K--L--L--F--V--N--R--L--K--G--K--K--Y--K--T--N--S--S--T--K--V--L--Q--D--A--S--N--S--I--D--H--R
CTGCAAAGCTACTCTTTGTCAACAGACTGAAGGGGAAAAAATACAAAACGAATTCCTCCACTAAAGTTCTCCAAGATGCCAGTAATTCTATTGACCACCG
:::::::::: :::::::::::::::.::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::
CTGCAAAGCTCCTCTTTGTCAACAGATTGAAAGGGAAAAAATACAAAACGAATTCCTCCACTAAAGTTCTCCAAGATGCCAGTAATTCCATTGACCACCG
S--A--K--L--L--F--V--N--R--L--K--G--K--K--Y--K--T--N--S--S--T--K--V--L--Q--D--A--S--N--S--I--D--H--R

------------------><--------------------------------------------------------------------------------
--I--P--N--S--Q--R--K--I--S--A--D--T--I--G--D--E--G--F--F--D--L--L--S--R--F--Q--S--N--R--M--D--D--Q-
AATTCCAAATTCTCAGAGGAAAATCAGTGCAGATACTATTGGAGATGAAGGGTTCTTTGACTTATTAAGCCGATTTCAAAGCAATAGGATGGATGATCAG
:::::::::.:::::.:::   :::::::::::::::::::::::::::::::::::::::.:.::::::::::::::::::::: ::::::::::::::
AATTCCAAACTCTCAAAGG---ATCAGTGCAGATACTATTGGAGATGAAGGGTTCTTTGACCTGTTAAGCCGATTTCAAAGCAATCGGATGGATGATCAG
--I--P--N--S--Q--R-----I--S--A--D--T--I--G--D--E--G--F--F--D--L--L--S--R--F--Q--S--N--R--M--D--D--Q-

------------------------------------------------------------------------------><--------------------
-R--C--C--L--Q--E--K--N--C--H--T--A--S--T--T--T--S--S--T--P--P--K--M--M--L--K--T--S--S--V--P--V--V--
AGATGTTGCTTACAAGAAAAGAACTGCCATACAGCTTCAACAACAACTTCTTCCACTCCCCCTAAAATGATGCTAAAAACATCATCTGTTCCTGTGGTAT
::.::.::::::::::::::::::: . .  ::::::: :::.::. :::::::::::::::.:.:::::::::::::   .: ::::.:.:.:::::.:
AGGTGCTGCTTACAAGAAAAGAACTCTGGATCAGCTTCTACAGCAGGTTCTTCCACTCCCCCCAGAATGATGCTAAAA---CCCTCTGCTTCCGTGGTGT
-R--C--C--L--Q--E--K--N--S--G--S--A--S--T--A--G--S--S--T--P--P--R--M--M--L--K-----P--S--A--S--V--V--

----------------------------------------------------------------------------------------------------
S--P--N--T--D--E--F--L--D--L--L--A--S--S--Q--S--R--R--L--D--D--Q--R--A--S--F--S--N--L--P--G--L--R--L
CCCCCAACACGGATGAGTTTTTAGATCTTCTTGCCAGCTCACAGAGTCGCCGTCTGGATGACCAGAGGGCTAGTTTCAGTAATTTGCCAGGGCTTCGTCT
::::::::::.::::::::::::::.::::::::::::::::::::.:::::::::::::::::::::::.:::::::::::.::::::::.::::::::
CCCCCAACACAGATGAGTTTTTAGACCTTCTTGCCAGCTCACAGAGCCGCCGTCTGGATGACCAGAGGGCCAGTTTCAGTAACTTGCCAGGACTTCGTCT
S--P--N--T--D--E--F--L--D--L--L--A--S--S--Q--S--R--R--L--D--D--Q--R--A--S--F--S--N--L--P--G--L--R--L

------------------------------------------------------------------------------------------------><--
--T--Q--N--S-----Q--S--V--L--S--H--L--M--T--N--D--N--K--E--A--D--E--D--F--F--D--I--L--V--K--C--Q--G-
AACACAAAACAGC---CAGTCGGTACTTAGCCACCTGATGACTAATGACAACAAAGAGGCTGATGAAGATTTCTTTGACATCCTTGTAAAATGTCAAGGA
.::::::::::.:   :::::. :::::.:::::::::::::::: ::::.::::::: ::::.::::::::::::::::::::::::::::::   ::.
GACACAAAACAACAATCAGTCACTACTTGGCCACCTGATGACTAAGGACAGCAAAGAGCCTGACGAAGATTTCTTTGACATCCTTGTAAAATGT---GGG
--T--Q--N--N--N--Q--S--L--L--G--H--L--M--T--K--D--S--K--E--P--D--E--D--F--F--D--I--L--V--K--C-----G-

----------------------------------------------------------------------------------------------------
-S--R--L--D--D--Q--R--C--A--P--P--P--A--T--T--K--G--P--T--V--P--D--E--D--F--F--S--L--I--L--R--S--Q--
TCCAGATTAGATGATCAAAGATGTGCTCCACCACCTGCTACCACAAAGGGTCCGACAGTACCAGATGAAGACTTTTTCAGCCTTATTTTACGGTCCCAGG
::: :::::::::::::::::::::: ::::::::::::.:::::::::: ::.::::::::.::::: ::::::::::::::::::::::::::.::::
TCCCGATTAGATGATCAAAGATGTGCACCACCACCTGCTGCCACAAAGGGACCAACAGTACCGGATGACGACTTTTTCAGCCTTATTTTACGGTCTCAGG
-S--R--L--D--D--Q--R--C--A--P--P--P--A--A--T--K--G--P--T--V--P--D--D--D--F--F--S--L--I--L--R--S--Q--

----------------------------------------------------------------------------------------------------
G--K--R--M--D--E--Q--R--V--L--L--Q--R--D--Q--N--R--D--T--D--F--G--L--K--D--F--L--Q--N--N--A--L--L--E
GAAAGAGAATGGATGAACAGAGAGTTCTTTTACAAAGAGATCAAAACAGAGACACTGACTTTGGGCTAAAGGACTTTTTGCAAAATAATGCTTTGTTGGA
 :::.::::::::::::::::::::::::.::::::.::::::::::::::::::::: .::::::::::::::.:::::::.:.:::::::::::::::
CAAAAAGAATGGATGAACAGAGAGTTCTTCTACAAAAAGATCAAAACAGAGACACTGAACTTGGGCTAAAGGACCTTTTGCAGAGTAATGCTTTGTTGGA
A--K--R--M--D--E--Q--R--V--L--L--Q--K--D--Q--N--R--D--T--E--L--G--L--K--D--L--L--Q--S--N--A--L--L--E

------------------------------------>
--F--K--N--S--G--K--K--S--A--D--H--*-
GTTTAAAAATTCAGGGAAAAAATCGGCAGACCATTAG
..:::::::::::::.::::::: .:: .::::.   
ACTTAAAAATTCAGGAAAAAAATAAGCCAACCAC---
--L--K--N--S--G--K--K--*--A--N--H----

Pig Consensus Sequence

>BGISUST0000878541
------------------------------------ATGGAAGCTTCTTGCCTAGAACTGGCCTTGGAAGGGGAGCGTCTGTGCAAATCAGGAGACTGCC
GTGCTGGTGTGTCATTCTTTGAAGCTGCAGTTCAAGTTGGAACTGAAGACCTAAAAACCCTTAGTGCTATTTACAGCCAGCTGGGCAATGCTTATTTCTA
TTTGCATGATTATGCCAAAGCATTAGAATACCATCATCATGATTTAACTCTT------ACTATTGGAGACCGGTTGGGGGAAGCCAAAGCTAGTGGCAAT
CTGGGAAACACCTTAAAGGTTCTTGGGAATTTTGATGAAGCGGTGGTTTGTTGTCAGCGACACTTAGATATTTCCAGAGAGCTAAATGACAAGGTAGGAG
AAGCAAGAGCACTTTACAATCTTGGAAATGTGTATCATGCCAAAGGGAAAAGCTTTGGCTGCCCTGGTCCTCAGGACGTAGGAGACTTTCCAGAAGAAGT
CAGAAACGCTCTGCAGGCAGCAGTGGATTATTAT---GAAAACCTATCACTGGTGACTGCTTTGGGTGACCGAGCAGCCCAAGGACGTGCCTTTGGAAAT
CTTGGAAACACACATTACCTCCTTGGCAACTTCCGGGATGCAGTCATAGCTCATGAGCAGCGTCTCCTTATTGCAAAAGAATTTGGAGATAAAGCAGCTG
AAAGAAGAGCCTATAGCAACCTTGGAAATGCATATATATTTCTTGGTGAATTTGAAACTGCCTCTGAATACTAC---AAGACACTACTGTTGGCTCGACA
GCTCAAAGACAGAGCTGTAGAAGCACAGGCTTGTTATAGTCTTGGGAACACACATACTTTACTTCAGGACTATGAAAAGGCCATTGACTATCATCTGAAG
CACTTGGCAATCGCCCAGGAGCTAAATGAT---------------------------------------------ACAGCTCTAGGAAATCATGATCAAG
CAATGCATTTTGCAGAAAAGCACTTGGAAATTTCAAGAGAGGTTGGAGATAAAAGTGGTGAACTAACAGCACGACTGAATCTCTCAGATCTTCAAATGGT
TCTTGGTTTGAGCTACAGCACAAACAATTCAGTAATGTCTGAAAATATTGAAATTGATAACAGTTTGCAT---GCACGCCCCAAGTTGGGACGCCGACAC
AGTATGGAAAACATGGAACTTATGAAGTTAACACCAGAAAAGGTACAAAACTGGAACAGTGAAATTCTTGCTAAACAAAAACCTCTTATTGCCAAACCTT
CTGCAAAGCTCCTCTTTGTCAACAGATTGAAAGGGAAAAAATACAAAACGAATTCCTCCACTAAAGTTCTCCAAGATGCCAGTAATTCCATTGACCACCG
AATTCCAAACTCTCAAAGG---ATCAGTGCAGATACTATTGGAGATGAAGGGTTCTTTGACCTGTTAAGCCGATTTCAAAGCAATCGGATGGATGATCAG
AGGTGCTGCTTACAAGAAAAGAACTCTGGATCAGCTTCTACAGCAGGTTCTTCCACTCCCCCCAGAATGATGCTAAAA---CCCTCTGCTTCCGTGGTGT
CCCCCAACACAGATGAGTTTTTAGACCTTCTTGCCAGCTCACAGAGCCGCCGTCTGGATGACCAGAGGGCCAGTTTCAGTAACTTGCCAGGACTTCGTCT
GACACAAAACAACAATCAGTCACTACTTGGCCACCTGATGACTAAGGACAGCAAAGAGCCTGACGAAGATTTCTTTGACATCCTTGTAAAA---GGGTCC
CGATTAGATGATCAAAGATGTGCACCACCACCTGCTGCCACAAAGGGACCAACAGTACCGGATGACGACTTTTTCAGCCTTATTTTACGGTCTCAGGCAA
AAAGAATGGATGAACAGAGAGTTCTTCTACAAAAAGATCAAAACAGAGACACTGAACTTGGGCTAAAGGACCTTTTGCAGAGTAATGCTTTGTTGGAACT
TAAAAATTCAGGAAAAAAATAAGCCAACCAC---


>BGISUSP0000878541
------------MEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTL--TIGDRLGEAKASGN
LGNTLKVLGNFDEAVVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGDFPEEVRNALQAAVDYY-ENLSLVTALGDRAAQGRAFGN
LGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYY-KTLLLARQLKDRAVEAQACYSLGNTHTLLQDYEKAIDYHLK
HLAIAQELND---------------TALGNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSVMSENIEIDNSLH-ARPKLGRRH
SMENMELMKLTPEKVQNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDHRIPNSQR-ISADTIGDEGFFDLLSRFQSNRMDDQ
RCCLQEKNSGSASTAGSSTPPRMMLK-PSASVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNNNQSLLGHLMTKDSKEPDEDFFDILVK-GS
RLDDQRCAPPPAATKGPTVPDDDFFSLILRSQAKRMDEQRVLLQKDQNRDTELGLKDLLQSNALLELKNSGKK*ANH-