Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000197106 (click for geneview)
Transcript ID ENST00000264132(link to ensembl)
Localtion Chromosome:1:110446636:110453108:1 band: 1p13.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--K--M--L--D--P--Q--V--W--R--E--A--A--T--Q--V--F--F--A--L--G--L--G--F--G--G--V--I--A--F--S--S--
CTGGACAAGATGCTGGACCCCCAGGTGTGGCGGGAGGCAGCTACCCAGGTCTTCTTTGCCTTGGGCCTGGGCTTTGGTGGTGTCATTGCCTTCTCCAGCT
::::::::::::::::::::::::::::::::::::::.::.::::::::::::::.:::.:::: ::::::::.:: ::.:::::.:::::::::::::
CTGGACAAGATGCTGGACCCCCAGGTGTGGCGGGAGGCGGCCACCCAGGTCTTCTTCGCCCTGGGGCTGGGCTTCGGGGGCGTCATCGCCTTCTCCAGCT
-L--D--K--M--L--D--P--Q--V--W--R--E--A--A--T--Q--V--F--F--A--L--G--L--G--F--G--G--V--I--A--F--S--S--

----------------------------------------------------------------------------------------------------
Y--N--K--Q--D--N--N--C--H--F--D--A--A--L--V--S--F--I--N--F--F--T--S--V--L--A--T--L--V--V--F--A--V--L
ACAATAAGCAGGACAACAACTGCCACTTCGATGCCGCCCTGGTGTCCTTCATCAACTTCTTCACGTCAGTGTTGGCCACCCTCGTGGTGTTTGCTGTGCT
::::.::::::::::::::::::::::::::.::::: :::::::::::::::::::::::::: ::.:::.:::::::::::::::::           
ACAACAAGCAGGACAACAACTGCCACTTCGACGCCGCACTGGTGTCCTTCATCAACTTCTTCACCTCGGTGCTGGCCACCCTCGTGGTG-----------
Y--N--K--Q--D--N--N--C--H--F--D--A--A--L--V--S--F--I--N--F--F--T--S--V--L--A--T--L--V--V------------

-----------------------------------------><---------------------------------------------------------
--G--F--K--A--N--I--M--N--E--K--C--V--V--E--N--A--E--K--I--L--G--Y--L--N--T--N--V--L--S--R--D--L--I-
GGGCTTCAAGGCCAACATCATGAATGAGAAGTGTGTGGTCGAGAATGCTGAGAAAATCCTAGGGTACCTTAACACCAACGTCCTGAGCCGGGACCTCATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--P--H--V--N--F--S--H--L--T--T--K--D--Y--M--E--M--Y--N--V--I--M--T--V--K--E--D--Q--F--S--A--L--G--
CCACCCCACGTCAACTTCTCCCACCTGACCACAAAGGACTACATGGAGATGTACAATGTCATCATGACCGTGAAGGAGGACCAGTTCTCAGCCCTGGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
L--D--P--C--L--L--E--D--E--L--D--K--S--V--Q--G--T--G--L--A--F--I--A--F--T--E--A--M--T--H--F--P--A--S
TTGACCCCTGCCTTCTGGAGGACGAGCTGGACAAGTCCGTGCAGGGCACAGGCCTGGCCTTCATCGCCTTCACTGAGGCCATGACGCACTTCCCCGCCTC
                                   ::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::
-----------------------------------TCCGTGCAGGGCACAGGCCTGGCCTTCATCGCCTTCACCGAGGCCATGACGCACTTCCCCGCCTC
------------------------------------S--V--Q--G--T--G--L--A--F--I--A--F--T--E--A--M--T--H--F--P--A--S

----------------------------------------------------------------------------------------------------
--P--F--W--S--V--M--F--F--L--M--L--I--N--L--G--L--G--S--M--I--G--T--M--A--G--I--T--T--P--I--I--D--T-
CCCGTTCTGGTCCGTCATGTTCTTCTTGATGCTTATCAACCTGGGCCTGGGCAGCATGATCGGGACCATGGCAGGCATCACCACGCCCATCATCGACACC
:::::::::::: ::::::::::::.:::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::
CCCGTTCTGGTCGGTCATGTTCTTCCTGATGCTCATCAACCTGGGCCTGGGCAGCATGATCGGGACCATGGCGGGCATCACCACGCCCATCATCGACACC
--P--F--W--S--V--M--F--F--L--M--L--I--N--L--G--L--G--S--M--I--G--T--M--A--G--I--T--T--P--I--I--D--T-

---------------------------><-----------------------------------------------------------------------
-F--K--V--P--K--E--M--F--T--V--G--C--C--V--F--A--F--L--V--G--L--L--F--V--Q--R--S--G--N--Y--F--V--T--
TTCAAGGTGCCCAAGGAGATGTTCACAGTGGGCTGCTGTGTCTTTGCATTCCTCGTGGGGCTGTTGTTCGTCCAGCGCTCCGGAAACTACTTTGTCACCA
:::::::::::::::::::::::::::   :::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::
TTCAAGGTGCCCAAGGAGATGTTCACA---GGCTGCTGTGTCTTTGCATTCTTCGTGGGGCTGTTGTTCGTCCAGCGCTCCGGAAACTACTTTGTCACCA
-F--K--V--P--K--E--M--F--T-----G--C--C--V--F--A--F--F--V--G--L--L--F--V--Q--R--S--G--N--Y--F--V--T--

---------------------------------------------------------------------------------------><-----------
M--F--D--D--Y--S--A--T--L--P--L--T--L--I--V--I--L--E--N--I--A--V--A--W--I--Y--G--T--K--K--F--M--Q--E
TGTTCGATGACTACTCGGCCACCCTGCCACTCACTCTCATCGTCATCCTTGAGAACATCGCTGTGGCCTGGATTTATGGAACCAAGAAGTTCATGCAGGA
::::.:::::::::::::::::::::::.:::::.:::::.:::::::::::::::.:::: :::::::::::.::::::::::::   :::::::::::
TGTTTGATGACTACTCGGCCACCCTGCCGCTCACCCTCATTGTCATCCTTGAGAACGTCGCGGTGGCCTGGATCTATGGAACCAAG---TTCATGCAGGA
M--F--D--D--Y--S--A--T--L--P--L--T--L--I--V--I--L--E--N--V--A--V--A--W--I--Y--G--T--K-----F--M--Q--E

----------------------------------------------------------------------------------------------------
--L--T--E--M--L--G--F--R--P--Y--R--F--Y--F--Y--M--W--K--F--V--S--P--L--C--M--A--V--L--T--T--A--S--I-
GCTGACGGAGATGCTGGGCTTCCGCCCCTACCGCTTCTATTTCTACATGTGGAAGTTCGTGTCTCCACTATGCATGGCTGTGCTCACCACAGCCAGCATC
::::::.::::::::::::::::: :::::::: :::::::::::::::::::::::::::::::::::.::::::::::::::::::::.:::::::::
GCTGACAGAGATGCTGGGCTTCCGGCCCTACCG-TTCTATTTCTACATGTGGAAGTTCGTGTCTCCACTGTGCATGGCTGTGCTCACCACGGCCAGCATC
--L--T--E--M--L--G--F--R--P--Y--R--F--Y--F--Y--M--W--K--F--V--S--P--L--C--M--A--V--L--T--T--A--S--I-

-----------------------------------------------------><---------------------------------------------
-I--Q--L--G--V--T--P--P--G--Y--S--A--W--I--K--E--E--A--A--E--R--Y--L--Y--F--P--N--W--A--M--A--L--L--
ATCCAGCTGGGGGTCACGCCCCCGGGCTACAGCGCCTGGATCAAGGAGGAGGCTGCCGAGCGCTACCTGTATTTCCCCAACTGGGCCATGGCACTCCTGA
::::::::::::::.::::::::::::::::::::::::::::::::::::                                                 
ATCCAGCTGGGGGTTACGCCCCCGGGCTACAGCGCCTGGATCAAGGAGGAG-------------------------------------------------
-I--Q--L--G--V--T--P--P--G--Y--S--A--W--I--K--E--E--------------------------------------------------

----------------------------------------------------------------------------------------------------
I--T--L--I--V--V--A--T--L--P--I--P--V--V--F--V--L--R--H--F--H--L--L--S--D--G--S--N--T--L--S--V--S--Y
TCACCCTCATCGTCGTGGCGACGCTGCCCATCCCTGTGGTGTTCGTCCTGCGGCACTTCCACCTGCTCTCTGATGGCTCCAACACCCTCTCCGTGTCCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--K--G--R--M--M--K--D--I--S--N--L--E--E--N--D--E--T--R--F--I--L--S--K--V--P--S--E--A--P--S--P--M-
CAAGAAGGGCCGCATGATGAAGGACATCTCCAACCTGGAGGAGAACGATGAGACCCGCTTCATCCTCAGCAAGGTGCCCAGTGAGGCACCTTCCCCCATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--T--H--R--S--Y--L--G--P--G--S--T--S--P--L--E--T--S--G--N--P--N--G--R--Y--G--S--G--Y--L--L--A--S--
CCCACTCACCGTTCCTATCTGGGGCCCGGCAGCACATCACCCCTGGAGACCAGCGGTAACCCCAATGGACGCTATGGGAGCGGCTACCTGCTGGCCAGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------
T--P--E--S--E--L--*-
CCCCTGAGTCGGAGCTGTGA
                    
--------------------
--------------------

Pig Consensus Sequence

>BGISUST0000894672
CTGGACAAGATGCTGGACCCCCAGGTGTGGCGGGAGGCGGCCACCCAGGTCTTCTTCGCCCTGGGGCTGGGCTTCGGGGGCGTCATCGCCTTCTCCAGCT
ACAACAAGCAGGACAACAACTGCCACTTCGACGCCGCACTGGTGTCCTTCATCAACTTCTTCACCTCGGTGCTGGCCACCCTCGTGGTG-----------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------TCCGTGCAGGGCACAGGCCTGGCCTTCATCGCCTTCACCGAGGCCATGACGCACTTCCCCGCCTC
CCCGTTCTGGTCGGTCATGTTCTTCCTGATGCTCATCAACCTGGGCCTGGGCAGCATGATCGGGACCATGGCGGGCATCACCACGCCCATCATCGACACC
TTCAAGGTGCCCAAGGAGATGTTCACA---GGCTGCTGTGTCTTTGCATTCTTCGTGGGGCTGTTGTTCGTCCAGCGCTCCGGAAACTACTTTGTCACCA
TGTTTGATGACTACTCGGCCACCCTGCCGCTCACCCTCATTGTCATCCTTGAGAACGTCGCGGTGGCCTGGATCTATGGAACCAAG---TTCATGCAGGA
GCTGACAGAGATGCTGGGCTTCCGGCCCTActTCTATTTCTACATGTGGAAGTTCGTGTCTCCACTGTGCATGGCTGTGCTCACCACGGCCAGCATCATC
CAGCTGGGGGTTACGCCCCCGGGCTACAGCGCCTGGATCAAGGAGGAG----------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------


>BGISUSP0000894672
MDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVV-------------------------------------
---------------------------------------------SVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMAGITTPIIDT
FKVPKEMFT-GCCVFAFFVGLLFVQRSGNYFVTMFDDYSATLPLTLIVILENVAVAWIYGTK-FMQELTEMLGFRPYFYFYMWKFVSPLCMAVLTTASII
QLGVTPPGYSAWIKEE------------------------------------------------------------------------------------
---------------------------------------