Sequences
EST Library Info
jej1Small intestine, jejunum
pigcb2Unavailable
spl3Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000093183 (click for geneview)
Transcript ID ENST00000264454(link to ensembl)
Symbol SEC22L3
Localtion Chromosome:3:42569403:42598432:-1 band: 3p22.1
Description vesicle trafficking protein isoform a [Source:RefSeq_peptide;Acc:NP_116752]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--V--I--F--F--A--C--V--V--R--V--R--D--G--L--P--L--S--A--S--T--D--F--Y--H--T--Q--D--F--L--E--W--
ATGTCCGTGATCTTTTTTGCCTGCGTGGTACGGGTAAGGGATGGACTGCCCCTCTCAGCCTCTACTGATTTTTACCACACCCAAGATTTTTTGGAATGGA
::::::.:::::.::::::::::.:::::: ::::.::::::::::::::.:::::.:::::.:::::.:::::::::::::::::::::.::::::: :
ATGTCCATGATCCTTTTTGCCTGTGTGGTAAGGGTGAGGGATGGACTGCCTCTCTCGGCCTCCACTGACTTTTACCACACCCAAGATTTTCTGGAATGCA
-M--S--M--I--L--F--A--C--V--V--R--V--R--D--G--L--P--L--S--A--S--T--D--F--Y--H--T--Q--D--F--L--E--C--

---------------------------------------------------------------------------------><-----------------
R--R--R--L--K--S--L--A--L--R--L--A--Q--Y--P--G--R--G--S--A--E--G--C--D--F--S--I--H--F--S--S--F--G--D
GGAGACGGCTCAAGAGTTTAGCCTTGCGACTGGCCCAGTATCCAGGTCGAGGTTCTGCAGAAGGTTGTGACTTTAGTATACATTTTTCTTCTTTCGGGGA
::::::::::::::: :::::::::::::.:::::::::::::::::::::::::::::.:::: .:::::::.:::      ::.:::::::. .::::
GGAGACGGCTCAAGACTTTAGCCTTGCGATTGGCCCAGTATCCAGGTCGAGGTTCTGCAAAAGGACGTGACTTCAGT------TTCTCTTCTTCGAGGGA
R--R--R--L--K--T--L--A--L--R--L--A--Q--Y--P--G--R--G--S--A--K--G--R--D--F--S--------F--S--S--S--R--D

----------------------------------------------------------------------------------------------------
--V--A--C--M--A--I--C--S--C--Q--C--P--A--A--M--A--F--C--F--L--E--T--L--W--W--E--F--T--A--S--Y--D--T-
CGTGGCCTGCATGGCTATCTGCTCCTGCCAGTGTCCAGCAGCCATGGCCTTCTGCTTCCTGGAGACCCTGTGGTGGGAATTCACAGCTTCCTATGACACT
.::::::::::::::::::::::::..:::::::::: : :::::::::::::.::::::::::::::::::::::::::::::::::::::::::.::.
TGTGGCCTGCATGGCTATCTGCTCCCACCAGTGTCCATCTGCCATGGCCTTCTACTTCCTGGAGACCCTGTGGTGGGAATTCACAGCTTCCTATGATACC
--V--A--C--M--A--I--C--S--H--Q--C--P--S--A--M--A--F--Y--F--L--E--T--L--W--W--E--F--T--A--S--Y--D--T-

---------------------------------------------><-----------------------------------------------------
-T--C--I--G--L--A--S--R--P--Y--A--F--L--E--F--D--S--I--I--Q--K--V--K--W--H--F--N--Y--V--S--S--S--Q--
ACCTGCATTGGCCTAGCCTCCAGGCCATACGCTTTTCTTGAGTTTGACAGCATCATTCAGAAAGTGAAGTGGCATTTTAACTATGTAAGTTCCTCTCAGA
::::::::::::::::::::::::::::::::.:::::.::.:::   ::..::::::::::::::::::::::::::::::::::::::::. :.::::
ACCTGCATTGGCCTAGCCTCCAGGCCATACGCCTTTCTCGAATTT---AGTGTCATTCAGAAAGTGAAGTGGCATTTTAACTATGTAAGTTCTACCCAGA
-T--C--I--G--L--A--S--R--P--Y--A--F--L--E--F-----S--V--I--Q--K--V--K--W--H--F--N--Y--V--S--S--T--Q--

----------------------------------------------------------------------------------------------------
M--E--C--S--L--E--K--I--Q--E--E--L--K--L--Q--P--P--A--V--L--T--L--E--D--T--D--V--A--N--G--V--M--N--G
TGGAGTGCAGCTTGGAAAAAATTCAGGAGGAGCTCAAGTTGCAGCCTCCAGCGGTTCTCACTCTGGAGGACACAGATGTGGCAAATGGGGTGATGAATGG
::::: .::::::.::::::::::::::::: :::::::: :::::.::::.:::::::::::::::::::::::::::::: :::::::::::::::::
TGGAGAACAGCTTAGAAAAAATTCAGGAGGACCTCAAGTTCCAGCCCCCAGTGGTTCTCACTCTGGAGGACACAGATGTGGCCAATGGGGTGATGAATGG
M--E--N--S--L--E--K--I--Q--E--D--L--K--F--Q--P--P--V--V--L--T--L--E--D--T--D--V--A--N--G--V--M--N--G

-------------------------><-------------------------------------------------------------------------
--H--T--P--M--H--L--E--P--A--P--N--F--R--M--E--P--V--T--A--L--G--I--L--S--L--I--L--N--I--M--C--A--A-
TCACACACCGATGCACTTGGAGCCTGCTCCTAATTTCCGAATGGAACCAGTGACAGCCCTGGGTATCCTCTCCCTCATTCTCAACATCATGTGTGCTGCC
:::::::: :::::::::::..:::   :::::::::::::::::.::::::::.:::::.:::.:.::.:::::.::::::::::::::::::::::::
TCACACACGGATGCACTTGGGACCT---CCTAATTTCCGAATGGAGCCAGTGACGGCCCTAGGTGTTCTTTCCCTTATTCTCAACATCATGTGTGCTGCC
--H--T--R--M--H--L--G--P-----P--N--F--R--M--E--P--V--T--A--L--G--V--L--S--L--I--L--N--I--M--C--A--A-

--------------------------------------------><------------------------------------------------------
-L--N--L--I--R--G--V--H--L--A--E--H--S--L--Q--V--A--H--E--E--I--G--N--I--L--A--F--L--V--P--F--V--A--
CTGAATCTCATTCGAGGAGTTCACCTTGCAGAACATTCTTTACAGGTTGCCCATGAGGAAATTGGAAACATTCTGGCTTTTCTTGTTCCTTTCGTAGCCT
:::::.:::::::: :::.::::::::::::::::::::::::::::::: :::::. ::::::::::.::.::::::::::::.:::::::.::.::::
CTGAACCTCATTCGTGGAATTCACCTTGCAGAACATTCTTTACAGGTTGCACATGAATAAATTGGAAATATCCTGGCTTTTCTTATTCCTTTTGTGGCCT
-L--N--L--I--R--G--I--H--L--A--E--H--S--L--Q--V--A--H--E--*--I--G--N--I--L--A--F--L--I--P--F--V--A--

----------><----------------------------------------------------------------------------------------
C--I--F--Q--C--Y--L--Y--L--F--Y--S--P--A--R--T--M--K--V--V--L--M--L--L--F--I--C--L--G--N--M--Y--L--H
GCATTTTCCAGTGTTATTTGTACCTGTTCTACAGTCCAGCCAGGACTATGAAGGTGGTGCTTATGCTGCTCTTTATTTGCCTGGGCAACATGTACCTGCA
::::::::::::::::.::::::::::::::.:::::::::::.::::::::::::::::: ::::::::.::.::::::::::::::::::::::::::
GCATTTTCCAGTGTTACTTGTACCTGTTCTATAGTCCAGCCAGAACTATGAAGGTGGTGCTGATGCTGCTTTTCATTTGCCTGGGCAACATGTACCTGCA
C--I--F--Q--C--Y--L--Y--L--F--Y--S--P--A--R--T--M--K--V--V--L--M--L--L--F--I--C--L--G--N--M--Y--L--H

----------------------------------------------------------------------------------------------------
--G--L--R--N--L--W--Q--I--L--F--H--I--G--V--A--F--L--S--S--Y--Q--I--L--T--R--Q--L--Q--E--K--Q--S--D-
CGGGCTGAGGAACCTCTGGCAAATCCTTTTCCACATAGGAGTGGCTTTTCTGTCTTCATATCAGATACTAACAAGGCAGCTTCAGGAGAAGCAGTCTGAC
.:::::::::::::::::::::::::::::::::::::::::::::::.:::::::::.::::::::::.::.:::::::::::::::::::::::::::
TGGGCTGAGGAACCTCTGGCAAATCCTTTTCCACATAGGAGTGGCTTTCCTGTCTTCACATCAGATACTGACGAGGCAGCTTCAGGAGAAGCAGTCTGAC
--G--L--R--N--L--W--Q--I--L--F--H--I--G--V--A--F--L--S--S--H--Q--I--L--T--R--Q--L--Q--E--K--Q--S--D-

----------->
-C--G--V--*-
TGTGGAGTATGA
::::::::.:::
TGTGGAGTGTGA
-C--G--V--*-

Pig Consensus Sequence

>BGISUST0000880730
ATGTCCATGATCCTTTTTGCCTGTGTGGTAAGGGTGAGGGATGGACTGCCTCTCTCGGCCTCCACTGACTTTTACCACACCCAAGATTTTCTGGAATGCA
GGAGACGGCTCAAGACTTTAGCCTTGCGATTGGCCCAGTATCCAGGTCGAGGTTCTGCAAAAGGACGTGACTTCAGT------TTCTCTTCTTCGAGGGA
TGTGGCCTGCATGGCTATCTGCTCCCACCAGTGTCCATCTGCCATGGCCTTCTACTTCCTGGAGACCCTGTGGTGGGAATTCACAGCTTCCTATGATACC
ACCTGCATTGGCCTAGCCTCCAGGCCATACGCCTTTCTCGAATTT---AGTGTCATTCAGAAAGTGAAGTGGCATTTTAACTATGTAAGTTCTACCCAGA
TGGAGAACAGCTTAGAAAAAATTCAGGAGGACCTCAAGTTCCAGCCCCCAGTGGTTCTCACTCTGGAGGACACAGATGTGGCCAATGGGGTGATGAATGG
TCACACACGGATGCACTTGGGACCT---CCTAATTTCCGAATGGAGCCAGTGACGGCCCTAGGTGTTCTTTCCCTTATTCTCAACATCATGTGTGCTGCC
CTGAACCTCATTCGTGGAATTCACCTTGCAGAACATTCTTTACAGGTTGCACATGAATAAATTGGAAATATCCTGGCTTTTCTTATTCCTTTTGTGGCCT
GCATTTTCCAGTGTTACTTGTACCTGTTCTATAGTCCAGCCAGAACTATGAAGGTGGTGCTGATGCTGCTTTTCATTTGCCTGGGCAACATGTACCTGCA
TGGGCTGAGGAACCTCTGGCAAATCCTTTTCCACATAGGAGTGGCTTTCCTGTCTTCACATCAGATACTGACGAGGCAGCTTCAGGAGAAGCAGTCTGAC
TGTGGAGTGTGA


>BGISUSP0000880730
MSMILFACVVRVRDGLPLSASTDFYHTQDFLECRRRLKTLALRLAQYPGRGSAKGRDFS--FSSSRDVACMAICSHQCPSAMAFYFLETLWWEFTASYDT
TCIGLASRPYAFLEF-SVIQKVKWHFNYVSSTQMENSLEKIQEDLKFQPPVVLTLEDTDVANGVMNGHTRMHLGP-PNFRMEPVTALGVLSLILNIMCAA
LNLIRGIHLAEHSLQVAHE*IGNILAFLIPFVACIFQCYLYLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSHQILTRQLQEKQSD
CGV*