Sequences
EST Library Info
cbe2Cerebellum
cst3Stomach - RNA from China
fhi1Unavailable
hea2Heart
mgp2Mammary gland - 7 days pre birth
pfco4Unavailable
pgl2Pituitary gland
ret1Retina
spc1Spinal cord
Clusters
Oligos
SNPs

Gene ID ENSG00000114279 (click for geneview)
Transcript ID ENST00000264730(link to ensembl)
Symbol FGF12
Localtion Chromosome:3:193343000:193609540:-1 band: 3q28
Description Fibroblast growth factor-12 (FGF-12) (Fibroblast growth factor homologous factor 1) (FHF-1) (Myocyte-activating factor).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--A--I--A--S--S--L--I--R--Q--K--R--Q--A--R--E--S--N--S--D--R--V--S--A--S--K--R--R--S--S--P--
ATGGCTGCGGCGATAGCCAGCTCCTTGATCCGGCAGAAGCGGCAGGCGAGGGAGTCCAACAGCGACCGAGTGTCGGCCTCCAAGCGCCGCTCCAGCCCCA
      ::.::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.::::::::::::::::::::.:::::.::::
------GCAGCGATAGCCAGCTCCTTGATCCGGCAGAAGCGACAGGCGAGGGAGTCCAACAGCGACCGGGTGTCGGCCTCCAAGCGCCGTTCCAGTCCCA
-------A--A--I--A--S--S--L--I--R--Q--K--R--Q--A--R--E--S--N--S--D--R--V--S--A--S--K--R--R--S--S--P--

--------------------------------------------------------------------------------------------------><
S--K--D--G--R--S--L--C--E--R--H--V--L--G--V--F--S--K--V--R--F--C--S--G--R--K--R--P--V--R--R--R--P--E
GCAAAGACGGGCGCTCCCTGTGCGAGAGGCACGTCCTCGGGGTGTTCAGCAAAGTGCGCTTCTGCAGCGGCCGCAAGAGGCCGGTGAGGCGGAGACCAGA
:::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::::::  
GCAAAGACGGGCGCTCCCTGTGCGAGAGGCACGTCCTCGGGGTATTCAGCAAAGTGCGCTTCTGCAGCGGCCGCAAGAGGCCAGTGAGGCGGAGACCA--
S--K--D--G--R--S--L--C--E--R--H--V--L--G--V--F--S--K--V--R--F--C--S--G--R--K--R--P--V--R--R--R--P---

----------------------------------------------------------------------------------------------------
--P--Q--L--K--G--I--V--T--R--L--F--S--Q--Q--G--Y--F--L--Q--M--H--P--D--G--T--I--D--G--T--K--D--E--N-
ACCCCAGCTCAAAGGGATTGTGACAAGGTTATTCAGCCAGCAGGGATACTTCCTGCAGATGCACCCAGATGGTACCATTGATGGGACCAAGGACGAAAAC
 :::::::: :::::.::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.::::::::::::::::::
-CCCCAGCTGAAAGGAATTGTGACAAGGTTATTCAGCCAGCAGGGATATTTCCTGCAGATGCACCCAGATGGTACCATTGACGGGACCAAGGACGAAAAC
--P--Q--L--K--G--I--V--T--R--L--F--S--Q--Q--G--Y--F--L--Q--M--H--P--D--G--T--I--D--G--T--K--D--E--N-

---------><-----------------------------------------------------------------------------------------
-S--D--Y--T--L--F--N--L--I--P--V--G--L--R--V--V--A--I--Q--G--V--K--A--S--L--Y--V--A--M--N--G--E--G--
AGCGACTACACTCTCTTCAATCTAATTCCCGTGGGCCTGCGTGTAGTGGCCATCCAAGGAGTGAAGGCTAGCCTCTATGTGGCCATGAATGGTGAAGGCT
:::::::::   ::::::::::::::::: ::::::::::::::.:::::::::::.::.::::::::.:::::::::::::::::::::::::::::::
AGCGACTAC---CTCTTCAATCTAATTCCAGTGGGCCTGCGTGTGGTGGCCATCCAGGGGGTGAAGGCCAGCCTCTATGTGGCCATGAATGGTGAAGGCT
-S--D--Y-----L--F--N--L--I--P--V--G--L--R--V--V--A--I--Q--G--V--K--A--S--L--Y--V--A--M--N--G--E--G--

-------------><-------------------------------------------------------------------------------------
Y--L--Y--S--S--D--V--F--T--P--E--C--K--F--K--E--S--V--F--E--N--Y--Y--V--I--Y--S--S--T--L--Y--R--Q--Q
ATCTCTACAGTTCAGATGTTTTCACTCCAGAATGCAAATTCAAGGAATCTGTGTTTGAAAACTACTATGTGATCTATTCTTCCACACTGTACCGCCAGCA
:::::::.::.:::::::::::::::::::::::::::::.::::::::::::::::::::.::::::::::::::::::::::::::::::::.:::::
ATCTCTATAGCTCAGATGTTTTCACTCCAGAATGCAAATTTAAGGAATCTGTGTTTGAAAATTACTATGTGATCTATTCTTCCACACTGTACCGTCAGCA
Y--L--Y--S--S--D--V--F--T--P--E--C--K--F--K--E--S--V--F--E--N--Y--Y--V--I--Y--S--S--T--L--Y--R--Q--Q

----------------------------------------------------------------------------------------------------
--E--S--G--R--A--W--F--L--G--L--N--K--E--G--Q--I--M--K--G--N--R--V--K--K--T--K--P--S--S--H--F--V--P-
AGAATCAGGCCGAGCTTGGTTTCTGGGACTCAATAAAGAAGGTCAAATTATGAAGGGGAACAGAGTGAAGAAAACCAAGCCCTCATCACATTTTGTACCG
::::::::::::::: ::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::.
AGAATCAGGCCGAGCATGGTTTCTGGGACTCAATAAAGAAGGTCAAATTATGAAGGGCAACAGAGTGAAGAAAACCAAGCCCTCATCACATTTTGTACCA
--E--S--G--R--A--W--F--L--G--L--N--K--E--G--Q--I--M--K--G--N--R--V--K--K--T--K--P--S--S--H--F--V--P-

------------><--------------------------------------------------------------------------------------
-K--P--I--E--V--C--M--Y--R--E--P--S--L--H--E--I--G--E--K--Q--G--R--S--R--K--S--S--G--T--P--T--M--N--
AAACCTATTGAAGTGTGTATGTACAGAGAACCATCGCTACATGAAATTGGAGAAAAACAAGGGCGTTCAAGGAAAAGTTCTGGAACACCAACCATGAATG
::::::::::::   ::::::::::::::.:::::.:::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::
AAACCTATTGAA---TGTATGTACAGAGAGCCATCACTACATGAAATTGGAGAAAAACAAGGGCGCTCGAGGAAAAGTTCTGGAACACCAACCATGAATG
-K--P--I--E-----C--M--Y--R--E--P--S--L--H--E--I--G--E--K--Q--G--R--S--R--K--S--S--G--T--P--T--M--N--

------------------------------->
G--G--K--V--V--N--Q--D--S--T--*-
GAGGCAAAGTTGTGAATCAAGATTCAACATAG
::::::::::::::::::::::::::::::::
GAGGCAAAGTTGTGAATCAAGATTCAACATAG
G--G--K--V--V--N--Q--D--S--T--*-

Pig Consensus Sequence

>BGISUST0000878132
------GCAGCGATAGCCAGCTCCTTGATCCGGCAGAAGCGACAGGCGAGGGAGTCCAACAGCGACCGGGTGTCGGCCTCCAAGCGCCGTTCCAGTCCCA
GCAAAGACGGGCGCTCCCTGTGCGAGAGGCACGTCCTCGGGGTATTCAGCAAAGTGCGCTTCTGCAGCGGCCGCAAGAGGCCAGTGAGGCGGAGACCA--
-CCCCAGCTGAAAGGAATTGTGACAAGGTTATTCAGCCAGCAGGGATATTTCCTGCAGATGCACCCAGATGGTACCATTGACGGGACCAAGGACGAAAAC
AGCGACTAC---CTCTTCAATCTAATTCCAGTGGGCCTGCGTGTGGTGGCCATCCAGGGGGTGAAGGCCAGCCTCTATGTGGCCATGAATGGTGAAGGCT
ATCTCTATAGCTCAGATGTTTTCACTCCAGAATGCAAATTTAAGGAATCTGTGTTTGAAAATTACTATGTGATCTATTCTTCCACACTGTACCGTCAGCA
AGAATCAGGCCGAGCATGGTTTCTGGGACTCAATAAAGAAGGTCAAATTATGAAGGGCAACAGAGTGAAGAAAACCAAGCCCTCATCACATTTTGTACCA
AAACCTATTGAA---TGTATGTACAGAGAGCCATCACTACATGAAATTGGAGAAAAACAAGGGCGCTCGAGGAAAAGTTCTGGAACACCAACCATGAATG
GAGGCAAAGTTGTGAATCAAGATTCAACATAG


>BGISUSP0000878132
--AAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP-PQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDEN
SDY-LFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVP
KPIE-CMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST*