Sequences
EST Library Info
cut7Uterus - RNA from China
nlu1Newborn 115 days, lung
Clusters
Oligos
SNPs

Gene ID ENSG00000038210 (click for geneview)
Transcript ID ENST00000264864(link to ensembl)
Symbol NP_060793.1
Localtion Chromosome:4:24911922:24956982:1 band: 4p15.2
Description phosphatidylinositol 4-kinase type-II beta
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--D--P--S--E--P--D--R--L--A--S--A--D--G--G--S--P--E--E--E--E--D--G--E--R--E--P--L--L--P--R--I--
ATGGAGGATCCCTCCGAGCCCGACCGGTTGGCGTCCGCGGACGGCGGGAGCCCGGAGGAGGAGGAGGATGGGGAGCGGGAGCCGCTGCTACCGCGGATCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--W--A--H--P--R--R--G--A--P--G--S--A--V--R--L--L--D--A--A--G--E--E--G--E--A--G--D--E--E--L--P--L--P
CCTGGGCCCACCCGCGGAGAGGCGCCCCAGGCAGCGCCGTGAGGCTGCTGGACGCTGCCGGGGAGGAGGGCGAGGCCGGCGACGAGGAGCTGCCCCTCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------><-------------------------------
--P--G--D--V--G--V--S--R--S--S--S--A--E--L--D--R--S--R--P--A--V--S--V--T--I--G--T--S--E--M--N--A--F-
GCCCGGGGACGTGGGGGTCTCCCGGAGTTCGTCCGCCGAGCTGGACCGGAGCCGCCCCGCGGTTTCAGTAACTATTGGTACTTCAGAGATGAATGCATTC
                                                                            ::: :::::::: :::::.:::::
----------------------------------------------------------------------------GGTTCTTCAGAGCTGAATACATTC
-----------------------------------------------------------------------------G--S--S--E--L--N--T--F-

----------------------------------------------------------------------------------------------------
-L--D--D--P--E--F--A--D--I--M--L--R--A--E--Q--A--I--E--V--G--I--F--P--E--R--I--S--Q--G--S--S--G--S--
TTGGATGACCCAGAATTTGCCGATATTATGCTGAGAGCAGAGCAAGCAATAGAAGTTGGAATTTTTCCAGAAAGAATCTCTCAAGGTTCAAGTGGAAGTT
::::::::.:::::::::::.::::.:::..:::.:::::::::.::::::::: :::::.::::::: :::::::::::::::::::::::::::::::
TTGGATGATCCAGAATTTGCTGATACTATATTGAAAGCAGAGCAGGCAATAGAATTTGGAGTTTTTCCCGAAAGAATCTCTCAAGGTTCAAGTGGAAGTT
-L--D--D--P--E--F--A--D--T--I--L--K--A--E--Q--A--I--E--F--G--V--F--P--E--R--I--S--Q--G--S--S--G--S--

----------------------><----------------------------------------------------------------------------
Y--F--V--K--D--P--K--R--K--I--I--G--V--F--K--P--K--S--E--E--P--Y--G--Q--L--N--P--K--W--T--K--Y--V--H
ACTTTGTGAAGGATCCTAAGAGGAAAATTATTGGTGTGTTTAAACCCAAATCAGAAGAGCCTTATGGTCAACTCAATCCAAAATGGACCAAATATGTCCA
::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.:: ::::::::::::::::::::.::.::
ACTTTGTGAAGGATCCTAAGAGGAAAATTATTGGTGTGTTTAAACCCAAATCGGAAGAGCCTTATGGTCAGCTGAATCCAAAATGGACCAAATACGTTCA
Y--F--V--K--D--P--K--R--K--I--I--G--V--F--K--P--K--S--E--E--P--Y--G--Q--L--N--P--K--W--T--K--Y--V--H

----------------------------------------------------------------------------------------------------
--K--V--C--C--P--C--C--F--G--R--G--C--L--I--P--N--Q--G--Y--L--S--E--A--G--A--Y--L--V--D--N--K--L--H-
TAAGGTCTGCTGCCCTTGCTGCTTTGGCCGAGGCTGCCTGATTCCTAATCAGGGGTACCTTTCCGAAGCGGGTGCCTATCTTGTGGACAACAAGCTTCAT
:::::::::::::::::::::::::::: ::::::::::: ::::.::::::::::::::::::::.:: ::.::.: .::::::::..: ::.::::::
TAAGGTCTGCTGCCCTTGCTGCTTTGGCAGAGGCTGCCTGCTTCCCAATCAGGGGTACCTTTCCGAGGCTGGCGCTTCCCTTGTGGATGAAAAACTTCAT
--K--V--C--C--P--C--C--F--G--R--G--C--L--L--P--N--Q--G--Y--L--S--E--A--G--A--S--L--V--D--E--K--L--H-

-----------------------><---------------------------------------------------------------------------
-L--S--I--V--P--K--T--K--V--V--W--L--V--S--E--T--F--N--Y--N--A--I--D--R--A--K--S--R--G--K--K--Y--A--
CTGAGCATTGTACCTAAAACAAAGGTGGTTTGGCTTGTCAGTGAGACATTTAACTATAATGCGATTGACCGTGCAAAATCAAGAGGCAAAAAGTATGCTT
:::..::::::::: :::::::.:::::::::::::::::::::::::::.:::::.:.:::.:::::::::::::::::  :.::::::::::::::::
CTGGACATTGTACCAAAAACAAGGGTGGTTTGGCTTGTCAGTGAGACATTCAACTACAGTGCAATTGACCGTGCAAAATCTCGGGGCAAAAAGTATGCTT
-L--D--I--V--P--K--T--R--V--V--W--L--V--S--E--T--F--N--Y--S--A--I--D--R--A--K--S--R--G--K--K--Y--A--

-------------------------------------------------------><-------------------------------------------
L--E--K--V--P--K--V--G--R--K--F--H--R--I--G--L--P--P--K--I--G--S--F--Q--L--F--V--E--G--Y--K--E--A--E
TAGAAAAAGTGCCAAAAGTGGGTAGAAAGTTTCATAGGATAGGACTCCCTCCTAAGATTGGTTCCTTTCAGTTATTTGTTGAAGGTTACAAGGAGGCTGA
:.::.::::::::.:::::.::::::::.:::::: ::.:::::::.::::::::::::::::::::::::.::::::::::::::::::::::::::::
TGGAGAAAGTGCCGAAAGTAGGTAGAAAATTTCATCGGGTAGGACTTCCTCCTAAGATTGGTTCCTTTCAGCTATTTGTTGAAGGTTACAAGGAGGCTGA
L--E--K--V--P--K--V--G--R--K--F--H--R--V--G--L--P--P--K--I--G--S--F--Q--L--F--V--E--G--Y--K--E--A--E

----------------------------------------------------------------------------------------------------
--Y--W--L--R--K--F--E--A--D--P--L--P--E--N--I--R--K--Q--F--Q--S--Q--F--E--R--L--V--I--L--D--Y--I--I-
ATATTGGCTTAGGAAATTTGAAGCTGACCCTTTGCCTGAGAATATTAGAAAACAATTTCAGTCACAATTTGAAAGATTAGTTATTTTGGATTACATCATC
::::::::::::::::::::::::.:::::::::::::::::::::::.:::::.:::::::::::::::::::::::::: :::: :::::::::::::
ATATTGGCTTAGGAAATTTGAAGCCGACCCTTTGCCTGAGAATATTAGGAAACAGTTTCAGTCACAATTTGAAAGATTAGTGATTTGGGATTACATCATC
--Y--W--L--R--K--F--E--A--D--P--L--P--E--N--I--R--K--Q--F--Q--S--Q--F--E--R--L--V--I--W--D--Y--I--I-

---------><------------------------------------------------------------------><---------------------
-R--N--T--D--R--G--N--D--N--W--L--V--R--Y--E--K--Q--K--C--E--K--E--I--D--H--K--E--S--K--W--I--D-----
AGAAATACAGACAGGGGCAATGATAATTGGTTAGTCAGATACGAAAAGCAGAAATGTGAAAAGGAAATTGACCATAAGGAATCAAAATGGATTGAT---G
:::::::::                                                                     ::: :::::::::. .::   :
AGAAATACA---------------------------------------------------------------------GAAGCAAAATGGACAAATGTGG
-R--N--T-----------------------------------------------------------------------E--A--K--W--T--N--V--

--------------------------------------------------------------------------------><------------------
D--E--E--F--L--I--K--I--A--A--I--D--N--G--L--A--F--P--F--K--H--P--D--E--W--R--A--Y--P--F--H--W--A--W
ATGAAGAATTCCTTATTAAAATAGCTGCAATTGATAATGGTCTAGCATTTCCTTTTAAACATCCTGATGAATGGAGAGCATATCCATTTCACTGGGCTTG
::.::::::. ::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::::.::::::      :::::::::::::::::
ATAAAGAATCACTTATTAAAATAGCTGCAATTGATAATGGTCTGGCATTTCCCTTTAAACATCCTGATGAGTGGAGA------CCATTTCACTGGGCTTG
D--K--E--S--L--I--K--I--A--A--I--D--N--G--L--A--F--P--F--K--H--P--D--E--W--R--------P--F--H--W--A--W

----------------------------------------------------------------------------------------------------
--L--P--Q--A--K--V--P--F--S--E--E--I--R--N--L--I--L--P--Y--I--S--D--M--N--F--V--Q--D--L--C--E--D--L-
GCTTCCTCAAGCAAAAGTTCCCTTTTCTGAAGAAATAAGAAATTTGATTCTACCATATATTTCTGACATGAACTTTGTGCAAGATTTATGTGAAGATCTC
:::::::::::::::::::::::::::::: :::::::::::..::.::::::::::::::::::::::::::::::::::::::::::::::::::::.
GCTTCCTCAAGCAAAAGTTCCCTTTTCTGATGAAATAAGAAACCTGGTTCTACCATATATTTCTGACATGAACTTTGTGCAAGATTTATGTGAAGATCTT
--L--P--Q--A--K--V--P--F--S--D--E--I--R--N--L--V--L--P--Y--I--S--D--M--N--F--V--Q--D--L--C--E--D--L-

--------------><----------------------------------------------------------><------------------------
-Y--E--L--F--K--T--D--K--G--F--D--K--A--T--F--E--S--Q--M--S--V--M--R--G--Q--I--L--N--L--T--Q--A--L--
TATGAACTTTTTAAGACTGACAAAGGATTTGACAAAGCCACTTTTGAAAGTCAGATGTCTGTGATGAGGGGTCAGATCTTAAACCTTACTCAGGCATTGA
::::::::::::::::::::::::.::::::::::::::::::::::::: ::::::::::::::: ::::.:::::::::::.::.::::::::..:::
TATGAACTTTTTAAGACTGACAAAAGATTTGACAAAGCCACTTTTGAAAGGCAGATGTCTGTGATGCGGGGCCAGATCTTAAATCTCACTCAGGCGCTGA
-Y--E--L--F--K--T--D--K--R--F--D--K--A--T--F--E--R--Q--M--S--V--M--R--G--Q--I--L--N--L--T--Q--A--L--

----------------------------------------------------------------------------------------------------
R--D--G--K--S--P--F--Q--L--V--Q--I--P--C--V--I--V--E--R--S--Q--G--G--S--Q--G--R--I--V--H--L--S--N--S
GAGACGGGAAGAGTCCTTTCCAGCTAGTACAGATACCTTGTGTGATTGTGGAACGCAGTCAAGGTGGAAGTCAGGGTCGGATTGTCCACCTGAGCAATTC
:.:::.::::::::::  : :::::.::.:::::.:::::::::::.:: ::.::::::::.::.:::.:.:::::::::::::::::::::::::.:::
GGGACAGGAAGAGTCCGGTGCAGCTGGTGCAGATGCCTTGTGTGATCGTCGAGCGCAGTCAGGGCGGAGGCCAGGGTCGGATTGTCCACCTGAGCAGTTC
R--D--R--K--S--P--V--Q--L--V--Q--M--P--C--V--I--V--E--R--S--Q--G--G--G--Q--G--R--I--V--H--L--S--S--S

------------------------------------------------>
--F--T--Q--T--V--N--C--R--K--P--F--F--S--S--W--*-
CTTTACCCAGACTGTCAATTGCAGGAAGCCATTTTTTTCCTCCTGGTAG
:::.::::::::.::: :.::::::::::::::.:::::::::::::::
CTTCACCCAGACCGTCCACTGCAGGAAGCCATTCTTTTCCTCCTGGTAG
--F--T--Q--T--V--H--C--R--K--P--F--F--S--S--W--*-

Pig Consensus Sequence

>BGISUST0000891010
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------GGTTCTTCAGAGCTGAATACATTC
TTGGATGATCCAGAATTTGCTGATACTATATTGAAAGCAGAGCAGGCAATAGAATTTGGAGTTTTTCCCGAAAGAATCTCTCAAGGTTCAAGTGGAAGTT
ACTTTGTGAAGGATCCTAAGAGGAAAATTATTGGTGTGTTTAAACCCAAATCGGAAGAGCCTTATGGTCAGCTGAATCCAAAATGGACCAAATACGTTCA
TAAGGTCTGCTGCCCTTGCTGCTTTGGCAGAGGCTGCCTGCTTCCCAATCAGGGGTACCTTTCCGAGGCTGGCGCTTCCCTTGTGGATGAAAAACTTCAT
CTGGACATTGTACCAAAAACAAGGGTGGTTTGGCTTGTCAGTGAGACATTCAACTACAGTGCAATTGACCGTGCAAAATCTCGGGGCAAAAAGTATGCTT
TGGAGAAAGTGCCGAAAGTAGGTAGAAAATTTCATCGGGTAGGACTTCCTCCTAAGATTGGTTCCTTTCAGCTATTTGTTGAAGGTTACAAGGAGGCTGA
ATATTGGCTTAGGAAATTTGAAGCCGACCCTTTGCCTGAGAATATTAGGAAACAGTTTCAGTCACAATTTGAAAGATTAGTGATTTGGGATTACATCATC
AGAAATACA---------------------------------------------------------------------GAAGCAAAATGGACAAATGTGG
ATAAAGAATCACTTATTAAAATAGCTGCAATTGATAATGGTCTGGCATTTCCCTTTAAACATCCTGATGAGTGG------CCATTTCACTGGGCTTGGCT
TCCTCAAGCAAAAGTTCCCTTTTCTGATGAAATAAGAAACCTGGTTCTACCATATATTTCTGACATGAACTTTGTGCAAGATTTATGTGAAGATCTTTAT
GAACTTTTTAAGACTGACAAAAGATTTGACAAAGCCACTTTTGAAAGGCAGATGTCTGTGATGCGGGGCCAGATCTTAAATCTCACTCAGGCGCTGAGGG
ACAGGAAGAGTCCGGTGCAGCTGGTGCAGATGCCTTGTGTGATCGTCGAGCGCAGTCAGGGCGGAGGCCAGGGTCGGATTGTCCACCTGAGCAGTTCCTT
CACCCAGACCGTCCACTGCAGGAAGCCATTCTTTTCCTCCTGGTAG


>BGISUSP0000891010
--------------------------------------------------------------------------------------------GSSELNTF
LDDPEFADTILKAEQAIEFGVFPERISQGSSGSYFVKDPKRKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQGYLSEAGASLVDEKLH
LDIVPKTRVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKFHRVGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPENIRKQFQSQFERLVIWDYII
RNT-----------------------EAKWTNVDKESLIKIAAIDNGLAFPFKHPDEW--PFHWAWLPQAKVPFSDEIRNLVLPYISDMNFVQDLCEDLY
ELFKTDKRFDKATFERQMSVMRGQILNLTQALRDRKSPVQLVQMPCVIVERSQGGGQGRIVHLSSSFTQTVHCRKPFFSSW*