Sequences
EST Library Info
ebs3Foetus 50 days, brain stem
pigcb1Unavailable
pldo1Unavailable
spl2Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000109680 (click for geneview)
Transcript ID ENST00000264866(link to ensembl)
Symbol TBC1D19
Localtion Chromosome:4:26261975:26433071:1 band: 4p15.2
Description TBC1 domain family member 19. [Source:Uniprot/SWISSPROT;Acc:Q8N5T2]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------------------------><
-M--L--Q--E--E--S--D--L--S--L--I--I--A--Q--I--V--Q--K--L--K--G--S--N--L--Y--S--Q--L--E--R--Q--A--W--
ATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGCTGGAACGGCAGGCCTGGG
   .::::::::::::::::.:: :::::::::::::::::::::::::::::::::::::.::::::::::::. :::::.::::::::::::::::: 
---CTGCAGGAGGAGTCGGATCTGTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGACTCCAATTTGTATGCTCAGTTGGAACGGCAGGCCTGG-
----L--Q--E--E--S--D--L--S--L--I--I--A--Q--I--V--Q--K--L--K--D--S--N--L--Y--A--Q--L--E--R--Q--A--W--

-----------------------------------------------------------------------><---------------------------
A--S--L--Q--R--P--E--I--K--L--E--S--L--K--E--D--I--K--E--F--F--K--I--S--G--W--E--K--K--L--Q--N--A--V
CCAGTCTTCAGAGACCTGAGATTAAACTTGAATCACTGAAAGAAGATATTAAGGAATTCTTTAAAATATCAGGTTGGGAGAAGAAACTTCAGAATGCTGT
  :::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::
--AGTCTTCAGAGACCTGAGATTAAACTTGAATCACTAAAAGAAGATATTAAGGAATTCTTTAAAATATCA---TGGGAGAAGAAACTTCAGAATGCTGT
---S--L--Q--R--P--E--I--K--L--E--S--L--K--E--D--I--K--E--F--F--K--I--S-----W--E--K--K--L--Q--N--A--V

-----------------><--------------------------------------------------------------------------><-----
--Y--S--E--L--S--V--F--P--L--P--S--H--P--A--A--P--P--E--H--L--K--E--P--L--V--Y--M--R--K--A--Q--G--S-
TTATAGTGAACTGAGTGTGTTTCCTTTACCTAGTCATCCTGCTGCACCTCCTGAACATCTTAAAGAACCTTTGGTATACATGAGGAAAGCACAGGGAAGT
 :::::::::::::::   :::::::::::::::::.::::::::::::::::::::::::::.:::::.:::::.::::::::::::::::::::::::
GTATAGTGAACTGAGT---TTTCCTTTACCTAGTCACCCTGCTGCACCTCCTGAACATCTTAAGGAACCCTTGGTGTACATGAGGAAAGCACAGGGAAGT
--Y--S--E--L--S-----F--P--L--P--S--H--P--A--A--P--P--E--H--L--K--E--P--L--V--Y--M--R--K--A--Q--G--S-

--------------------------------------------------------------------><------------------------------
-W--E--K--R--I--L--K--S--L--N--S--M--C--T--E--L--S--I--P--L--A--R--K--R--P--V--G--E--Q--K--E--L--L--
TGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTATCCCACTGGCACGAAAGAGGCCAGTTGGAGAACAGAAAGAACTTCTTA
::::::::::::::::::::::::::::::::::::::::::::::::::.::::::.::::.:::::::::::::::::::::::::::::::::::.:
TGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGCATCCCATTGGCGCGAAAGAGGCCAGTTGGAGAACAGAAAGAACTTCTCA
-W--E--K--R--I--L--K--S--L--N--S--M--C--T--E--L--S--I--P--L--A--R--K--R--P--V--G--E--Q--K--E--L--L--

--------------------------------><---------------------------------------------><-------------------
N--K--W--N--E--M--G--T--D--E--P--D--L--S--L--F--R--P--V--Y--A--P--K--D--F--L--E--V--L--I--N--L--R--N
ATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCCTTTTCAGACCTGTTTATGCACCTAAGGATTTTCTTGAGGTATTAATTAATCTTCGCAA
::::::::::::::::::::::::::::::::   :::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::
ATAAATGGAATGAAATGGGAACTGATGAACCA---TTAAGCCTTTTCAGACCTGTTTACGCACCTAAGGATTTTCTTGAGGTATTAATTAATCTTCGCAA
N--K--W--N--E--M--G--T--D--E--P-----L--S--L--F--R--P--V--Y--A--P--K--D--F--L--E--V--L--I--N--L--R--N

------------------------------------------------------------------------------------------><--------
--P--N--Y--E--N--G--D--S--L--S--F--R--T--H--L--G--L--I--Q--V--P--L--K--V--K--D--I--P--E--L--K--E--C-
CCCAAATTATGAAAACGGTGATTCTCTTAGTTTCAGGACTCATTTGGGTTTAATTCAAGTTCCACTGAAAGTAAAAGACATCCCTGAATTGAAAGAATGC
::::::::::::::..::::::::::::::::::::::::::::::::::::::.:::::::: :: ::::::::::::::::::::.:::::::::: :
CCCAAATTATGAAAGTGGTGATTCTCTTAGTTTCAGGACTCATTTGGGTTTAATCCAAGTTCCTCTCAAAGTAAAAGACATCCCTGAGTTGAAAGAATTC
--P--N--Y--E--S--G--D--S--L--S--F--R--T--H--L--G--L--I--Q--V--P--L--K--V--K--D--I--P--E--L--K--E--F-

---------------------------------------------------------------><-----------------------------------
-F--V--E--L--G--L--N--I--G--Q--L--G--I--D--D--S--T--Q--V--P--P--E--L--F--E--N--E--H--V--R--I--G--Q--
TTTGTGGAACTTGGCTTAAATATAGGACAACTGGGTATAGATGATTCTACACAAGTGCCTCCTGAACTTTTTGAAAATGAACATGTACGTATTGGGCAAA
:::::.::.::.:::::.  ::.:::::::::::::::::::::.::::::::::::::::::   ::::::::::::::.:::::::::::::::::::
TTTGTAGAGCTCGGCTTGTCTACAGGACAACTGGGTATAGATGACTCTACACAAGTGCCTCCT---CTTTTTGAAAATGAGCATGTACGTATTGGGCAAA
-F--V--E--L--G--L--S--T--G--Q--L--G--I--D--D--S--T--Q--V--P--P-----L--F--E--N--E--H--V--R--I--G--Q--

--><------------------------------------------------------------------------------------------------
K--V--L--A--E--Q--D--S--A--A--A--Q--Q--Y--I--R--Q--G--S--P--T--A--L--R--A--E--L--W--A--L--I--L--N--I
AAGTTCTAGCAGAACAAGATAGTGCTGCTGCTCAACAGTACATCAGACAAGGAAGTCCCACGGCACTGAGAGCTGAATTGTGGGCTCTCATTTTGAATAT
::   ::.:::::::::::.::::::::::::::.:::::.::: ::::::::::::::::.::::::::::::::::::::::: ::::::::::::::
AA---CTGGCAGAACAAGACAGTGCTGCTGCTCAGCAGTATATCCGACAAGGAAGTCCCACAGCACTGAGAGCTGAATTGTGGGCGCTCATTTTGAATAT
K-----L--A--E--Q--D--S--A--A--A--Q--Q--Y--I--R--Q--G--S--P--T--A--L--R--A--E--L--W--A--L--I--L--N--I

---------------><-------------------------------------------------------------------------><--------
--S--S--Q--P--E--D--V--L--Y--Y--E--Q--L--K--T--N--V--I--Q--H--D--L--L--V--D--S--L--I--Y--K--D--V--K-
TTCCAGCCAACCTGAGGATGTCTTGTATTATGAGCAGCTTAAGACCAATGTGATACAACATGACCTTTTGGTGGACAGTCTAATCTATAAAGATGTGAAG
::::::.::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::
TTCCAGTCAACCTGAGGATATCTTGTATTATGAGCAGCTTAAGACCAATGTGATACAACATGACCTTTTGGTGGATAGTCTAATTTATAAAGATGTGAAG
--S--S--Q--P--E--D--I--L--Y--Y--E--Q--L--K--T--N--V--I--Q--H--D--L--L--V--D--S--L--I--Y--K--D--V--K-

-----------------------------------------------------><---------------------------------------------
-L--T--A--S--N--D--D--Y--Y--F--V--F--E--D--Y--L--Y--Q--V--L--L--C--F--S--R--D--T--S--V--L--S--H--F--
TTGACAGCAAGCAATGATGATTATTATTTTGTATTTGAAGATTATTTATATCAGGTATTACTTTGTTTTTCCCGGGATACATCTGTGTTGAGTCACTTTG
::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::.:::::::::::::::::::::::::
TTGACAGCAAGCAACGATGATTATTATTTTGTATTTGAAGATTATTTATATCAGGTATTACTTTGTTTTTCACGAGATACATCTGTGTTGAGTCACTTTG
-L--T--A--S--N--D--D--Y--Y--F--V--F--E--D--Y--L--Y--Q--V--L--L--C--F--S--R--D--T--S--V--L--S--H--F--

--------------------------------------><-------------------------------------------><---------------
A--F--N--S--A--S--P--P--K--S--Y--I--R--G--K--L--G--L--E--E--Y--A--V--F--Y--P--P--N--G--V--I--P--F--H
CATTCAACAGTGCCTCGCCACCAAAATCATACATAAGAGGAAAACTAGGACTGGAAGAATATGCTGTCTTTTACCCACCAAATGGTGTTATCCCTTTTCA
::: :::::::::.::.::.::.::::: :::::::::   :::::::::::.::::::::::::::::::::.:::::::::                 
CATACAACAGTGCTTCACCGCCGAAATCCTACATAAGA---AAACTAGGACTAGAAGAATATGCTGTCTTTTATCCACCAAAT-----------------
A--Y--N--S--A--S--P--P--K--S--Y--I--R-----K--L--G--L--E--E--Y--A--V--F--Y--P--P--N------------------

----------------><----------------------------------------------------------------------------------
--G--F--S--M--Y--V--A--P--L--C--F--L--Y--H--E--P--S--K--L--Y--Q--I--F--R--E--M--Y--V--R--F--F--F--R-
TGGATTTTCAATGTATGTTGCACCACTTTGTTTTCTATACCATGAACCTTCCAAATTGTATCAGATATTCCGTGAGATGTATGTGCGTTTTTTCTTCAGA
                   :: :::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::
-------------------GCTCCACTTTGTTTTCTATACCATGAACCTTCCAAACTGTATCAGATATTCCGTGAGATGTATGTGCGTTTTTTCTTCAGA
--------------------A--P--L--C--F--L--Y--H--E--P--S--K--L--Y--Q--I--F--R--E--M--Y--V--R--F--F--F--R-

--------------------------><------------------------------------------------------------------------
-L--H--S--I--S--S--H--P--S--G--I--V--S--L--C--L--L--F--E--T--L--L--Q--T--Y--L--P--Q--L--F--Y--H--L--
CTCCATTCCATCTCTTCTCATCCTTCTGGTATTGTGTCACTCTGTCTGCTGTTTGAAACTCTTCTTCAAACTTATCTTCCCCAACTCTTTTATCATCTAC
::.::::::::::::::::::::::::::::::::::::::::::::::::::.::::: :::::::::::::::::.::::::::::::::::::::::
CTTCATTCCATCTCTTCTCATCCTTCTGGTATTGTGTCACTCTGTCTGCTGTTCGAAACGCTTCTTCAAACTTATCTCCCCCAACTCTTTTATCATCTAC
-L--H--S--I--S--S--H--P--S--G--I--V--S--L--C--L--L--F--E--T--L--L--Q--T--Y--L--P--Q--L--F--Y--H--L--

------------------><--------------------------------------------------------------------------------
R--E--I--G--A--Q--P--L--R--I--S--F--K--W--M--V--R--A--F--S--G--Y--L--A--T--D--Q--L--L--L--L--W--D--R
GAGAAATTGGGGCTCAACCACTTCGCATATCATTTAAGTGGATGGTTCGAGCTTTCTCTGGATACTTAGCTACAGATCAGCTCTTGCTTTTATGGGATAG
:::::::::::::::::   :::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::::::::::.::::::::
GAGAAATTGGGGCTCAA---CTTCGCATATCATTTAAATGGATGGTTCGAGCTTTCTCTGGATACTTAGCTACAGATCAACTCTTGCTTTTGTGGGATAG
R--E--I--G--A--Q-----L--R--I--S--F--K--W--M--V--R--A--F--S--G--Y--L--A--T--D--Q--L--L--L--L--W--D--R

----------------------------------><----------------------------------------------------------------
--I--L--G--Y--N--S--L--E--I--L--A--V--L--A--A--A--V--F--A--F--R--A--V--N--L--M--E--V--T--S--L--A--A-
AATCCTAGGATACAACTCTCTGGAAATTCTTGCTGTGCTGGCAGCTGCCGTGTTTGCTTTCCGAGCAGTGAACCTGATGGAGGTGACATCACTGGCTGCA
::::::::::::::::::::::::::::::::::   :::::::::::.::::::::::::::::::::::::::::::::::::::::::         
AATCCTAGGATACAACTCTCTGGAAATTCTTGCT---CTGGCAGCTGCTGTGTTTGCTTTCCGAGCAGTGAACCTGATGGAGGTGACATCA---------
--I--L--G--Y--N--S--L--E--I--L--A-----L--A--A--A--V--F--A--F--R--A--V--N--L--M--E--V--T--S----------

-----><------------------------------------------------------------------------->
-A--E--A--V--L--A--D--L--S--T--L--K--V--M--P--L--L--Q--I--F--L--F--A--T--V--T--*-
GCTGAAGCAGTTCTTGCTGACCTTTCTACTTTAAAAGTTATGCCTCTTCTTCAGATTTTTCTGTTTGCTACTGTCACCTGA
      :::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::
------GCAGTTCTTGCTGACCTTTCTACTTTAAAAGTTATGCCTCTTCTTCAGATTTTCCTGTTTGCTACTGTCACCTGA
-------A--V--L--A--D--L--S--T--L--K--V--M--P--L--L--Q--I--F--L--F--A--T--V--T--*-

Pig Consensus Sequence

>BGISUST0000888466
---CTGCAGGAGGAGTCGGATCTGTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGACTCCAATTTGTATGCTCAGTTGGAACGGCAGGCCTGG-
--AGTCTTCAGAGACCTGAGATTAAACTTGAATCACTAAAAGAAGATATTAAGGAATTCTTTAAAATATCA---TGGGAGAAGAAACTTCAGAATGCTGT
GTATAGTGAACTGAGT---TTTCCTTTACCTAGTCACCCTGCTGCACCTCCTGAACATCTTAAGGAACCCTTGGTGTACATGAGGAAAGCACAGGGAAGT
TGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGCATCCCATTGGCGCGAAAGAGGCCAGTTGGAGAACAGAAAGAACTTCTCA
ATAAATGGAATGAAATGGGAACTGATGAACCA---TTAAGCCTTTTCAGACCTGTTTACGCACCTAAGGATTTTCTTGAGGTATTAATTAATCTTCGCAA
CCCAAATTATGAAAGTGGTGATTCTCTTAGTTTCAGGACTCATTTGGGTTTAATCCAAGTTCCTCTCAAAGTAAAAGACATCCCTGAGTTGAAAGAATTC
TTTGTAGAGCTCGGCTTGTCTACAGGACAACTGGGTATAGATGACTCTACACAAGTGCCTCCT---CTTTTTGAAAATGAGCATGTACGTATTGGGCAAA
AA---CTGGCAGAACAAGACAGTGCTGCTGCTCAGCAGTATATCCGACAAGGAAGTCCCACAGCACTGAGAGCTGAATTGTGGGCGCTCATTTTGAATAT
TTCCAGTCAACCTGAGGATATCTTGTATTATGAGCAGCTTAAGACCAATGTGATACAACATGACCTTTTGGTGGATAGTCTAATTTATAAAGATGTGAAG
TTGACAGCAAGCAACGATGATTATTATTTTGTATTTGAAGATTATTTATATCAGGTATTACTTTGTTTTTCACGAGATACATCTGTGTTGAGTCACTTTG
CATACAACAGTGCTTCACCGCCGAAATCCTACATAAGA---AAACTAGGACTAGAAGAATATGCTGTCTTTTATCCACCAAAT-----------------
-------------------GCTCCACTTTGTTTTCTATACCATGAACCTTCCAAACTGTATCAGATATTCCGTGAGATGTATGTGCGTTTTTTCTTCAGA
CTTCATTCCATCTCTTCTCATCCTTCTGGTATTGTGTCACTCTGTCTGCTGTTCGAAACGCTTCTTCAAACTTATCTCCCCCAACTCTTTTATCATCTAC
GAGAAATTGGGGCTCAA---CTTCGCATATCATTTAAATGGATGGTTCGAGCTTTCTCTGGATACTTAGCTACAGATCAACTCTTGCTTTTGTGGGATAG
AATCCTAGGATACAACTCTCTGGAAATTCTTGCT---CTGGCAGCTGCTGTGTTTGCTTTCCGAGCAGTGAACCTGATGGAGGTGACATCA---------
------GCAGTTCTTGCTGACCTTTCTACTTTAAAAGTTATGCCTCTTCTTCAGATTTTCCTGTTTGCTACTGTCACCTGA


>BGISUSP0000888466
-LQEESDLSLIIAQIVQKLKDSNLYAQLERQAW-SLQRPEIKLESLKEDIKEFFKIS-WEKKLQNAVYSELS-FPLPSHPAAPPEHLKEPLVYMRKAQGS
WEKRILKSLNSMCTELSIPLARKRPVGEQKELLNKWNEMGTDEP-LSLFRPVYAPKDFLEVLINLRNPNYESGDSLSFRTHLGLIQVPLKVKDIPELKEF
FVELGLSTGQLGIDDSTQVPP-LFENEHVRIGQK-LAEQDSAAAQQYIRQGSPTALRAELWALILNISSQPEDILYYEQLKTNVIQHDLLVDSLIYKDVK
LTASNDDYYFVFEDYLYQVLLCFSRDTSVLSHFAYNSASPPKSYIR-KLGLEEYAVFYPPN------------APLCFLYHEPSKLYQIFREMYVRFFFR
LHSISSHPSGIVSLCLLFETLLQTYLPQLFYHLREIGAQ-LRISFKWMVRAFSGYLATDQLLLLWDRILGYNSLEILA-LAAAVFAFRAVNLMEVTS---
--AVLADLSTLKVMPLLQIFLFATVT*