Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
pldo4Unavailable
ssp1M. Supraspinatus
uio1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000109819 (click for geneview)
Transcript ID ENST00000264867(link to ensembl)
Symbol PPARGC1A
Localtion Chromosome:4:23469914:23567969:-1 band: 4p15.2
Description Peroxisome proliferator activated receptor gamma coactivator 1 alpha (PPAR gamma coactivator-1 alpha) (PPARGC-1 alpha) (PGC-1 alpha) (Ligand effect modulator-6). [Source:Uniprot/SWISSPROT;Acc:Q9UBK2]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------><---------------------------------------------
-M--A--W--D--M--C--N--Q--D--S--E--S--V--W--S--D--I--E--C--A--A--L--V--G--E--D--Q--P--L--C--P--D--L--
ATGGCGTGGGACATGTGCAACCAGGACTCTGAGTCTGTATGGAGTGACATCGAGTGTGCTGCTCTGGTTGGTGAAGACCAGCCTCTTTGCCCAGATCTTC
                                                      ::::::::::::::::::::::::::::::::::::::::::::::
------------------------------------------------------TGTGCTGCTCTGGTTGGTGAAGACCAGCCTCTTTGCCCAGATCTTC
-------------------------------------------------------C--A--A--L--V--G--E--D--Q--P--L--C--P--D--L--

----------------------------------------------------------------------------------------------------
P--E--L--D--L--S--E--L--D--V--N--D--L--D--T--D--S--F--L--G--G--L--K--W--C--S--D--Q--S--E--I--I--S--N
CTGAACTTGATCTTTCTGAACTAGATGTGAACGACTTGGATACAGACAGCTTTCTGGGTGGACTCAAGTGGTGCAGTGACCAATCAGAAATAATATCCAA
::::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CTGAACTTGACCTTTCTGAACTAGACGTGAACGACTTGGATACAGACAGCTTTCTGGGTGGACTCAAGTGGTGCAGTGACCAATCAGAAATAATATCCAA
P--E--L--D--L--S--E--L--D--V--N--D--L--D--T--D--S--F--L--G--G--L--K--W--C--S--D--Q--S--E--I--I--S--N

---------------------------------><-----------------------------------------------------------------
--Q--Y--N--N--E--P--S--N--I--F--E--K--I--D--E--E--N--E--A--N--L--L--A--V--L--T--E--T--L--D--S--L--P-
TCAGTACAACAATGAGCCTTCAAACATATTTGAGAAGATAGATGAAGAGAATGAGGCAAACTTGCTAGCAGTCCTCACAGAGACACTAGACAGTCTCCCT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.::.::::::::::::
TCAGTACAACAATGAGCCTTCAAACATATTTGAGAAGATAGATGAAGAGAATGAGGCAAACTTGCTAGCAGTTCTCACAGAGACGCTGGACAGTCTCCCT
--Q--Y--N--N--E--P--S--N--I--F--E--K--I--D--E--E--N--E--A--N--L--L--A--V--L--T--E--T--L--D--S--L--P-

----------------------------------------------------------------------------------------------------
-V--D--E--D--G--L--P--S--F--D--A--L--T--D--G--D--V--T--T--D--N--E--A--S--P--S--S--M--P--D--G--T--P--
GTGGATGAAGACGGATTGCCCTCATTTGATGCGCTGACAGATGGAGACGTGACCACTGACAATGAGGCTAGTCCTTCCTCCATGCCTGACGGCACCCCTC
::::::::::::::::::::::::::::::::.::::::::::::::.::::::::::: ::::::::::::::::::::::::::::::::::::::::
GTGGATGAAGACGGATTGCCCTCATTTGATGCACTGACAGATGGAGATGTGACCACTGAGAATGAGGCTAGTCCTTCCTCCATGCCTGACGGCACCCCTC
-V--D--E--D--G--L--P--S--F--D--A--L--T--D--G--D--V--T--T--E--N--E--A--S--P--S--S--M--P--D--G--T--P--

----------------------------><----------------------------------------------------------------------
P--P--Q--E--A--E--E--P--S--L--L--K--K--L--L--L--A--P--A--N--T--Q--L--S--Y--N--E--C--S--G--L--S--T--Q
CACCCCAGGAGGCAGAAGAGCCGTCTCTACTTAAGAAGCTCTTACTGGCACCAGCCAACACTCAGCTAAGTTATAATGAATGCAGTGGTCTCAGTACCCA
:.::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CGCCTCAGGAGGCAGAAGAGCCGTCTCTACTTAAGAAGCTCTTACTGGCACCAGCCAACACTCAGCTAAGTTATAATGAATGCAGTGGTCTCAGTACCCA
P--P--Q--E--A--E--E--P--S--L--L--K--K--L--L--L--A--P--A--N--T--Q--L--S--Y--N--E--C--S--G--L--S--T--Q

---------------------------------------------------><-----------------------------------------------
--N--H--A--N--H--N--H--R--I--R--T--N--P--A--I--V--K--T--E--N--S--W--S--N--K--A--K--S--I--C--Q--Q--Q-
GAACCATGCAAATCACAATCACAGGATCAGAACAAACCCTGCAATTGTTAAGACTGAGAATTCATGGAGCAATAAAGCGAAGAGTATTTGTCAACAGCAA
::::::::::::.::::::::::::::::::::::::::::::.::::::::::.:::::::::::::::::::::::::::::.:::::::::::::::
GAACCATGCAAACCACAATCACAGGATCAGAACAAACCCTGCAGTTGTTAAGACCGAGAATTCATGGAGCAATAAAGCGAAGAGCATTTGTCAACAGCAA
--N--H--A--N--H--N--H--R--I--R--T--N--P--A--V--V--K--T--E--N--S--W--S--N--K--A--K--S--I--C--Q--Q--Q-

----------------------------------------------------------------------------------------------------
-K--P--Q--R--R--P--C--S--E--L--L--K--Y--L--T--T--N--D--D--P--P--H--T--K--P--T--E--N--R--N--S--S--R--
AAGCCACAAAGACGTCCCTGCTCGGAGCTTCTCAAATATCTGACCACAAACGATGACCCTCCTCACACCAAACCCACAGAGAACAGAAACAGCAGCAGAG
::::::::::::::::: ::::: :::::::::::.::::::::::::::.::::::::::::::::::::::::::::::: : :::::::.:::::::
AAGCCACAAAGACGTCCATGCTCCGAGCTTCTCAAGTATCTGACCACAAATGATGACCCTCCTCACACCAAACCCACAGAGACCCGAAACAGTAGCAGAG
-K--P--Q--R--R--P--C--S--E--L--L--K--Y--L--T--T--N--D--D--P--P--H--T--K--P--T--E--T--R--N--S--S--R--

--------------------------------------------------------><------------------------------------------
D--K--C--T--S--K--K--K--S--H--T--Q--S--Q--S--Q--H--L--Q--A--K--P--T--T--L--S--L--P--L--T--P--E--S--P
ACAAATGCACCTCCAAAAAGAAGTCCCACACACAGTCGCAGTCACAACACTTACAAGCCAAACCAACAACTTTATCTCTTCCTCTGACCCCAGAGTCACC
::::.:::::::::::::::::: ::::::::::.::::::::.:::::.::::::   ::::::::: :::::::::::::::::::::::::::::::
ACAAGTGCACCTCCAAAAAGAAGGCCCACACACAATCGCAGTCGCAACATTTACAA---AAACCAACATCTTTATCTCTTCCTCTGACCCCAGAGTCACC
D--K--C--T--S--K--K--K--A--H--T--Q--S--Q--S--Q--H--L--Q-----K--P--T--S--L--S--L--P--L--T--P--E--S--P

--><------------------------------------------------------------------------><----------------------
--N--D--P--K--G--S--P--F--E--N--K--T--I--E--R--T--L--S--V--E--L--S--G--T--A--G--L--T--P--P--T--T--P-
AAATGACCCCAAGGGTTCCCCATTTGAGAACAAGACTATTGAACGCACCTTAAGTGTGGAACTCTCTGGAACTGCAGGCCTAACTCCACCCACCACTCCT
:   ::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::   ::::::::: :::: ::::::
A---GACCCCAAGGGTTCCCCATTTGAGAACAAGACTATTGAACGAACCTTAAGTGTGGAACTCTCTGGAACTGCA---CTAACTCCAGCCACAACTCCT
-----D--P--K--G--S--P--F--E--N--K--T--I--E--R--T--L--S--V--E--L--S--G--T--A-----L--T--P--A--T--T--P-

----------------------------------------------------------------------------------------------------
-P--H--K--A--N--Q--D--N--P--F--R--A--S--P--K--L--K--S--S--C--K--T--V--V--P--P--P--S--K--K--P--R--Y--
CCTCATAAAGCCAACCAAGATAACCCTTTTAGGGCTTCTCCAAAGCTGAAGTCCTCTTGCAAGACTGTGGTGCCACCACCATCAAAGAAGCCCAGGTACA
:::::::::::::::::::::::::::::::::::::::::::::::::::.::.::::::::::::::::.:: ::.:::::.:::::: :: ::::::
CCTCATAAAGCCAACCAAGATAACCCTTTTAGGGCTTCTCCAAAGCTGAAGCCCCCTTGCAAGACTGTGGTACCTCCGCCATCGAAGAAGACCCGGTACA
-P--H--K--A--N--Q--D--N--P--F--R--A--S--P--K--L--K--P--P--C--K--T--V--V--P--P--P--S--K--K--T--R--Y--

----------------------------------------------------------------------------------------------------
S--E--S--S--G--T--Q--G--N--N--S--T--K--K--G--P--E--Q--S--E--L--Y--A--Q--L--S--K--S--S--V--L--T--G--G
GTGAGTCTTCTGGTACACAAGGCAATAACTCCACCAAGAAAGGGCCGGAGCAATCCGAGTTGTATGCACAACTCAGCAAGTCCTCAGTCCTCACTGGTGG
:::::::::: :: :: :: :::::.:::::::::::::::::::: :::::.::::::.::::.::.::.::::::::: : :: :. :::. .::.::
GTGAGTCTTCGGGGACCCACGGCAACAACTCCACCAAGAAAGGGCCCGAGCAGTCCGAGCTGTACGCGCAGCTCAGCAAGACGTCCGCGCTCGGCGGCGG
S--E--S--S--G--T--H--G--N--N--S--T--K--K--G--P--E--Q--S--E--L--Y--A--Q--L--S--K--T--S--A--L--G--G--G

----------------------------------------------------------------------------------------------------
--H--E--E--R--K--T--K--R--P--S--L--R--L--F--G--D--H--D--Y--C--Q--S--I--N--S--K--T--E--I--L--I--N--I-
ACACGAGGAAAGGAAGACCAAGCGGCCCAGTCTGCGGCTGTTTGGTGACCATGACTATTGCCAGTCAATTAATTCCAAAACAGAAATACTCATTAATATA
:::::::::: :::::.:::.::::::::::::::::::.::::::::::::::::::::.:::::.::::::::::::.:.::::: :::::.::::::
ACACGAGGAACGGAAGGCCAGGCGGCCCAGTCTGCGGCTATTTGGTGACCATGACTATTGTCAGTCGATTAATTCCAAAGCGGAAATCCTCATCAATATA
--H--E--E--R--K--A--R--R--P--S--L--R--L--F--G--D--H--D--Y--C--Q--S--I--N--S--K--A--E--I--L--I--N--I-

----------------------------------------------------------------------------------------------------
-S--Q--E--L--Q--D--S--R--Q--L--E--N--K--D--V--S--S--D--W--Q--G--Q--I--C--S--S--T--D--S--D--Q--C--Y--
TCACAGGAGCTCCAAGACTCTAGACAACTAGAAAATAAAGATGTCTCCTCTGATTGGCAGGGGCAGATTTGTTCTTCCACAGATTCAGACCAGTGCTACC
::.::::::::::: :::::.:::::::::::   ::::::::.: :::::::.::::::.::::::: ::::::::::::::.::::::::: ::::::
TCGCAGGAGCTCCACGACTCCAGACAACTAGACTCTAAAGATGCCGCCTCTGACTGGCAGAGGCAGATGTGTTCTTCCACAGACTCAGACCAGAGCTACC
-S--Q--E--L--H--D--S--R--Q--L--D--S--K--D--A--A--S--D--W--Q--R--Q--M--C--S--S--T--D--S--D--Q--S--Y--

----------------------------------------------------------------------------------------------------
L--R--E--T--L--E--A--S--K--Q--V--S--P--C--S--T--R--K--Q--L--Q--D--Q--E--I--R--A--E--L--N--K--H--F--G
TGAGAGAGACTTTGGAGGCAAGCAAGCAGGTCTCTCCTTGCAGCACAAGAAAACAGCTCCAAGACCAGGAAATCCGAGCCGAGCTGAACAAGCACTTCGG
:::  ::::: :.::::::.::::.::::::::::::  :::::.:  ::::::::::::::::::::                                
TGACCGAGACGTCGGAGGCGAGCAGGCAGGTCTCTCCGGGCAGCGCCCGAAAACAGCTCCAAGACCAG--------------------------------
L--T--E--T--S--E--A--S--R--Q--V--S--P--G--S--A--R--K--Q--L--Q--D--Q---------------------------------

----------------------------------------------------------------------------------------------------
--H--P--S--Q--A--V--F--D--D--E--A--D--K--T--G--E--L--R--D--S--D--F--S--N--E--Q--F--S--K--L--P--M--F-
TCATCCCAGTCAAGCTGTTTTTGACGACGAAGCAGACAAGACCGGTGAACTGAGGGACAGTGATTTCAGTAATGAACAATTCTCCAAACTACCTATGTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--N--S--G--L--A--M--D--G--L--F--D--D--S--E--D--E--S--D--K--L--S--Y--P--W--D--G--T--Q--S--Y--S--L--
ATAAATTCAGGACTAGCCATGGATGGCCTGTTTGATGACAGCGAAGATGAAAGTGATAAACTGAGCTACCCTTGGGATGGCACGCAATCCTATTCATTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--N--V--S--P--S--C--S--S--F--N--S--P--C--R--D--S--V--S--P--P--K--S--L--F--S--Q--R--P--Q--R--M--R--S
TCAATGTGTCTCCTTCTTGTTCTTCTTTTAACTCTCCATGTAGAGATTCTGTGTCACCACCCAAATCCTTATTTTCTCAAAGACCCCAAAGGATGCGCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------><------
--R--S--R--S--F--S--R--H--R--S--C--S--R--S--P--Y--S--R--S--R--S--R--S--P--G--S--R--S--S--S--R--S--C-
TCGTTCAAGGTCCTTTTCTCGACACAGGTCGTGTTCCCGATCACCATATTCCAGGTCAAGATCAAGGTCTCCAGGCAGTAGATCCTCTTCAAGATCCTGC
                                                                                              ::.:::
----------------------------------------------------------------------------------------------TCTTGC
-----------------------------------------------------------------------------------------------S--C-

-------------------------------------------------------------------------------------------------><-
-Y--Y--Y--E--S--S--H--Y--R--H--R--T--H--R--N--S--P--L--Y--V--R--S--R--S--R--S--P--Y--S--R--R--P--R--
TATTACTATGAGTCAAGCCACTACAGACACCGCACGCACCGAAATTCTCCCTTGTATGTGAGATCACGTTCAAGATCGCCCTACAGCCGTCGGCCCAGGT
::.:::: :::::::.::::::.::::::::::::::::::::::::::::.:::..:. ::::::::::::::::: ::::::::::: ::::::   :
TACTACTCTGAGTCAGGCCACTGCAGACACCGCACGCACCGAAATTCTCCCCTGTGCGCCAGATCACGTTCAAGATCTCCCTACAGCCGGCGGCCC---T
-Y--Y--S--E--S--G--H--C--R--H--R--T--H--R--N--S--P--L--C--A--R--S--R--S--R--S--P--Y--S--R--R--P-----

----------------------------------------------------------------------------------------------------
Y--D--S--Y--E--E--Y--Q--H--E--R--L--K--R--E--E--Y--R--R--E--Y--E--K--R--E--S--E--R--A--K--Q--R--E--R
ATGACAGCTACGAGGAATATCAGCACGAGAGGCTGAAGAGGGAAGAATATCGCAGAGAGTATGAGAAGCGAGAGTCTGAGAGGGCCAAGCAAAGGGAGAG
:::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.::::::::.:::::::::::.::::::::
ATGACAGCTACGAGGAATATCAGCACGAGAGGCTGAAGAGGGAAGAATACCGCAGAGAGTATGAGAAGCGGGAGTCTGAAAGGGCCAAGCAGAGGGAGAG
Y--D--S--Y--E--E--Y--Q--H--E--R--L--K--R--E--E--Y--R--R--E--Y--E--K--R--E--S--E--R--A--K--Q--R--E--R

------------------><--------------------------------------------------------------------------------
--Q--R--Q--K--A--I--E--E--R--R--V--I--Y--V--G--K--I--R--P--D--T--T--R--T--E--L--R--D--R--F--E--V--F-
GCAGAGGCAGAAGGCAATTGAAGAGCGCCGTGTGATTTATGTCGGTAAAATCAGACCTGACACAACACGGACAGAACTGAGGGACCGTTTTGAAGTTTTT
::::::::::::::::::::::::.::.::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GCAGAGGCAGAAGGCAATTGAAGAACGTCGTGTGATTTATGTTGGTAAAATCAGACCTGACACAACACGGACAGAACTGAGGGACCGTTTTGAAGTTTTT
--Q--R--Q--K--A--I--E--E--R--R--V--I--Y--V--G--K--I--R--P--D--T--T--R--T--E--L--R--D--R--F--E--V--F-

----------------------------------------><----------------------------------------------------------
-G--E--I--E--E--C--T--V--N--L--R--D--D--G--D--S--Y--G--F--I--T--Y--R--Y--T--C--D--A--F--A--A--L--E--
GGTGAAATTGAGGAGTGCACAGTAAATCTGCGGGATGATGGAGACAGCTATGGTTTCATTACCTACCGTTATACCTGTGATGCTTTTGCTGCTCTTGAAA
:::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGTGAAATTGAGGAGTGCACAGTAAATCTGCGGGATGAT---GACAGCTATGGTTTCATTACCTACCGTTATACCTGTGATGCTTTTGCTGCTCTTGAAA
-G--E--I--E--E--C--T--V--N--L--R--D--D-----D--S--Y--G--F--I--T--Y--R--Y--T--C--D--A--F--A--A--L--E--

--------------------------------------------------------------------------------------------><------
N--G--Y--T--L--R--R--S--N--E--T--D--F--E--L--Y--F--C--G--R--K--Q--F--F--K--S--N--Y--A--D--L--D--S--N
ATGGATACACTTTGCGCAGGTCAAACGAAACTGACTTTGAGCTGTACTTTTGTGGACGCAAGCAATTTTTCAAGTCTAACTATGCAGACCTAGATTCAAA
::::::::::::::::::::::.::.:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::
ATGGATACACTTTGCGCAGGTCGAATGAAACTGACTTCGAGCTGTACTTTTGTGGACGCAAGCAATTTTTCAAGTCTAACTATGCAGACCTA---TCAAA
N--G--Y--T--L--R--R--S--N--E--T--D--F--E--L--Y--F--C--G--R--K--Q--F--F--K--S--N--Y--A--D--L-----S--N

------------------------------------------------------------------------------------------------>
--S--D--D--F--D--P--A--S--T--K--S--K--Y--D--S--L--D--F--D--S--L--L--K--E--A--Q--R--S--L--R--R--*-
CTCAGATGACTTTGACCCTGCTTCCACCAAGAGCAAGTATGACTCTCTGGATTTTGATAGTTTACTGAAAGAAGCTCAGAGAAGCTTGCGCAGGTAA
.::::::::::::::.::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::
TTCAGATGACTTTGATCCTGCTTCCACCAAGAGCAAGTATGACTCTCTGGATTTCGATAGTTTACTGAAAGAAGCTCAGAGAAGCTTGCGCAGGTAA
--S--D--D--F--D--P--A--S--T--K--S--K--Y--D--S--L--D--F--D--S--L--L--K--E--A--Q--R--S--L--R--R--*-

Pig Consensus Sequence

>BGISUST0000876154
------------------------------------------------------TGTGCTGCTCTGGTTGGTGAAGACCAGCCTCTTTGCCCAGATCTTC
CTGAACTTGACCTTTCTGAACTAGACGTGAACGACTTGGATACAGACAGCTTTCTGGGTGGACTCAAGTGGTGCAGTGACCAATCAGAAATAATATCCAA
TCAGTACAACAATGAGCCTTCAAACATATTTGAGAAGATAGATGAAGAGAATGAGGCAAACTTGCTAGCAGTTCTCACAGAGACGCTGGACAGTCTCCCT
GTGGATGAAGACGGATTGCCCTCATTTGATGCACTGACAGATGGAGATGTGACCACTGAGAATGAGGCTAGTCCTTCCTCCATGCCTGACGGCACCCCTC
CGCCTCAGGAGGCAGAAGAGCCGTCTCTACTTAAGAAGCTCTTACTGGCACCAGCCAACACTCAGCTAAGTTATAATGAATGCAGTGGTCTCAGTACCCA
GAACCATGCAAACCACAATCACAGGATCAGAACAAACCCTGCAGTTGTTAAGACCGAGAATTCATGGAGCAATAAAGCGAAGAGCATTTGTCAACAGCAA
AAGCCACAAAGACGTCCATGCTCCGAGCTTCTCAAGTATCTGACCACAAATGATGACCCTCCTCACACCAAACCCACAGAGACCCGAAACAGTAGCAGAG
ACAAGTGCACCTCCAAAAAGAAGGCCCACACACAATCGCAGTCGCAACATTTACAA---AAACCAACATCTTTATCTCTTCCTCTGACCCCAGAGTCACC
A---GACCCCAAGGGTTCCCCATTTGAGAACAAGACTATTGAACGAACCTTAAGTGTGGAACTCTCTGGAACTGCA---CTAACTCCAGCCACAACTCCT
CCTCATAAAGCCAACCAAGATAACCCTTTTAGGGCTTCTCCAAAGCTGAAGCCCCCTTGCAAGACTGTGGTACCTCCGCCATCGAAGAAGACCCGGTACA
GTGAGTCTTCGGGGACCCACGGCAACAACTCCACCAAGAAAGGGCCCGAGCAGTCCGAGCTGTACGCGCAGCTCAGCAAGACGTCCGCGCTCGGCGGCGG
ACACGAGGAACGGAAGGCCAGGCGGCCCAGTCTGCGGCTATTTGGTGACCATGACTATTGTCAGTCGATTAATTCCAAAGCGGAAATCCTCATCAATATA
TCGCAGGAGCTCCACGACTCCAGACAACTAGACTCTAAAGATGCCGCCTCTGACTGGCAGAGGCAGATGTGTTCTTCCACAGACTCAGACCAGAGCTACC
TGACCGAGACGTCGGAGGCGAGCAGGCAGGTCTCTCCGGGCAGCGCCCGAAAACAGCTCCAAGACCAG--------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------TCTTGC
TACTACTCTGAGTCAGGCCACTGCAGACACCGCACGCACCGAAATTCTCCCCTGTGCGCCAGATCACGTTCAAGATCTCCCTACAGCCGGCGGCCC---T
ATGACAGCTACGAGGAATATCAGCACGAGAGGCTGAAGAGGGAAGAATACCGCAGAGAGTATGAGAAGCGGGAGTCTGAAAGGGCCAAGCAGAGGGAGAG
GCAGAGGCAGAAGGCAATTGAAGAACGTCGTGTGATTTATGTTGGTAAAATCAGACCTGACACAACACGGACAGAACTGAGGGACCGTTTTGAAGTTTTT
GGTGAAATTGAGGAGTGCACAGTAAATCTGCGGGATGAT---GACAGCTATGGTTTCATTACCTACCGTTATACCTGTGATGCTTTTGCTGCTCTTGAAA
ATGGATACACTTTGCGCAGGTCGAATGAAACTGACTTCGAGCTGTACTTTTGTGGACGCAAGCAATTTTTCAAGTCTAACTATGCAGACCTA---TCAAA
TTCAGATGACTTTGATCCTGCTTCCACCAAGAGCAAGTATGACTCTCTGGATTTCGATAGTTTACTGAAAGAAGCTCAGAGAAGCTTGCGCAGGTAA


>BGISUSP0000876154
------------------CAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLP
VDEDGLPSFDALTDGDVTTENEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNPAVVKTENSWSNKAKSICQQQ
KPQRRPCSELLKYLTTNDDPPHTKPTETRNSSRDKCTSKKKAHTQSQSQHLQ-KPTSLSLPLTPESP-DPKGSPFENKTIERTLSVELSGTA-LTPATTP
PHKANQDNPFRASPKLKPPCKTVVPPPSKKTRYSESSGTHGNNSTKKGPEQSELYAQLSKTSALGGGHEERKARRPSLRLFGDHDYCQSINSKAEILINI
SQELHDSRQLDSKDAASDWQRQMCSSTDSDQSYLTETSEASRQVSPGSARKQLQDQ--------------------------------------------
--------------------------------------------------------------------------------------------------SC
YYSESGHCRHRTHRNSPLCARSRSRSPYSRRP-YDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVF
GEIEECTVNLRDD-DSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADL-SNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR*