Sequences
EST Library Info
cst2Stomach - RNA from China
eep1Foetus 50 days, epidermis
eje1Foetus 50 days, jejunum
fhi1Unavailable
hea1Heart
nca2Newborn 115 days, cartillage
pgl2Pituitary gland
pigcb2Unavailable
pro1Prostata
uio2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000114021 (click for geneview)
Transcript ID ENST00000265259(link to ensembl)
Symbol NIT2
Localtion Chromosome:3:101536258:101556881:1 band: 3q12.2
Description nitrilase family, member 2 [Source:RefSeq_peptide;Acc:NP_064587]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----><--------------------------------------------------------------------------------------------
-M--T--S--F--R--L--A--L-----I--Q--L--Q--I--S--S--I--K--S--D--N--V--T--R--A--C--S--F--I--R--E--A--A--
ATGACCTCTTTCCGCTTGGCCCTC---ATCCAGCTTCAGATTTCTTCCATCAAATCAGATAACGTCACTCGCGCTTGTAGCTTCATCCGGGAGGCAGCAA
         ::::::::::: ::    .:::::::::: .:::::::..:::::::::::::: ::::::: ::::::.::::.::::.:::::::::::
---------TTCCGCTTGGCACTGA--GTCCAGCTTCACGTTTCTTCTGTCAAATCAGATAACCTCACTCGGGCTTGTGGCTTTATCCAGGAGGCAGCAA
----------F--R--L--A--L--\--I--Q--L--H--V--S--S--V--K--S--D--N--L--T--R--A--C--G--F--I--Q--E--A--A--

----------------------------><----------------------------------------------------------------------
T--Q--G--A--K--I--V--S--L--P--E--C--F--N--S--P--Y--G--A--K--Y--F--P--E--Y--A--E--K--I--P--G--E--S--T
CGCAAGGAGCCAAAATAGTTTCTTTGCCGGAATGCTTTAATTCTCCATATGGAGCGAAATATTTTCCTGAATATGCAGAGAAAATTCCTGGTGAATCCAC
 ::::::::::::::::.:::: .::   ::::::::::::::::::::::: .::::::::::::: :::::::::::::::::::::::::: :::::
AGCAAGGAGCCAAAATAATTTCGCTG---GAATGCTTTAATTCTCCATATGGCACGAAATATTTTCCGGAATATGCAGAGAAAATTCCTGGTGACTCCAC
K--Q--G--A--K--I--I--S--L-----E--C--F--N--S--P--Y--G--T--K--Y--F--P--E--Y--A--E--K--I--P--G--D--S--T

-------------------------------------------------><-------------------------------------------------
--Q--K--L--S--E--V--A--K--E--C--S--I--Y--L--I--G--G--S--I--P--E--E--D--A--G--K--L--Y--N--T--C--A--V-
ACAGAAGCTTTCTGAAGTAGCAAAGGAATGCAGCATATATCTCATTGGAGGCTCTATCCCTGAAGAGGATGCTGGGAAATTATATAACACCTGTGCTGTG
.:::::::: :::::::::::::::::.:::.::.::::: ::::::::   ::.::.::::::::::::::.::.::::::::::::::.::::::::.
GCAGAAGCTGTCTGAAGTAGCAAAGGAGTGCGGCGTATATGTCATTGGA---TCCATTCCTGAAGAGGATGCCGGAAAATTATATAACACTTGTGCTGTA
--Q--K--L--S--E--V--A--K--E--C--G--V--Y--V--I--G-----S--I--P--E--E--D--A--G--K--L--Y--N--T--C--A--V-

--------------------------------------><------------------------------------------------------------
-F--G--P--D--G--T--L--L--A--K--Y--R--K--I--H--L--F--D--I--D--V--P--G--K--I--T--F--Q--E--S--K--T--L--
TTTGGGCCTGATGGAACTTTACTAGCAAAGTATAGAAAGATCCATCTGTTTGACATTGATGTTCCTGGAAAAATTACATTTCAAGAATCTAAAACATTGA
:::::::::::::::::::::::.::::::::.::::::   ::::::::::::::::::::::::::.:::::.:::::::::::::::::::::.:::
TTTGGGCCTGATGGAACTTTACTGGCAAAGTACAGAAAG---CATCTGTTTGACATTGATGTTCCTGGGAAAATCACATTTCAAGAATCTAAAACACTGA
-F--G--P--D--G--T--L--L--A--K--Y--R--K-----H--L--F--D--I--D--V--P--G--K--I--T--F--Q--E--S--K--T--L--

--------------------------------><------------------------------------------------------------------
S--P--G--D--S--F--S--T--F--D--T--P--Y--C--R--V--G--L--G--I--C--Y--D--M--R--F--A--E--L--A--Q--I--Y--A
GTCCGGGTGATAGTTTCTCCACATTTGATACTCCTTACTGCAGAGTGGGTCTGGGCATCTGCTACGACATGCGGTTTGCAGAGCTTGCACAAATCTACGC
:::: :::::::::::::::::::::::::::   ::::::::.:::::.:::::::::::::::::::: :: ::::::::::: :::::::::::.::
GTCCTGGTGATAGTTTCTCCACATTTGATACT---TACTGCAGGGTGGGCCTGGGCATCTGCTACGACATCCGCTTTGCAGAGCTGGCACAAATCTATGC
S--P--G--D--S--F--S--T--F--D--T-----Y--C--R--V--G--L--G--I--C--Y--D--I--R--F--A--E--L--A--Q--I--Y--A

-------><-----------------------------------------------------------------------------><------------
--Q--R--G--C--Q--L--L--V--Y--P--G--A--F--N--L--T--T--G--P--A--H--W--E--L--L--Q--R--S--R--A--V--D--N-
ACAGAGAGGCTGCCAGCTGTTGGTATATCCAGGAGCTTTTAATCTGACCACTGGACCAGCCCATTGGGAGTTACTTCAGCGAAGCCGGGCTGTTGATAAT
:::::::   :::::::::::.:::::::: ::::::::::::.::::::::::::::::::::::::::.:.:::::::::      ::::::::::::
ACAGAGA---TGCCAGCTGTTAGTATATCCTGGAGCTTTTAATTTGACCACTGGACCAGCCCATTGGGAGCTGCTTCAGCGA------GCTGTTGATAAT
--Q--R-----C--Q--L--L--V--Y--P--G--A--F--N--L--T--T--G--P--A--H--W--E--L--L--Q--R--------A--V--D--N-

-------------------------------------------------------------------------------------><-------------
-Q--V--Y--V--A--T--A--S--P--A--R--D--D--K--A--S--Y--V--A--W--G--H--S--T--V--V--N--P--W--G--E--V--L--
CAGGTGTATGTGGCCACAGCCTCTCCTGCCCGGGATGACAAAGCCTCCTATGTTGCCTGGGGACACAGCACCGTGGTGAACCCTTGGGGGGAGGTTCTAG
::::::::.::::::::::: ::::: :::::::::::::::::::::::::::::::::::::::::::::.: ::::..:::                
CAGGTGTACGTGGCCACAGCATCTCCGGCCCGGGATGACAAAGCCTCCTATGTTGCCTGGGGACACAGCACCATTGTGAGTCCT----------------
-Q--V--Y--V--A--T--A--S--P--A--R--D--D--K--A--S--Y--V--A--W--G--H--S--T--I--V--S--P-----------------

-----------------------------------------><---------------------------------------------------------
A--K--A--G--T--E--E--A--I--V--Y--S--D--I--D--L--K--K--L--A--E--I--R--Q--Q--I--P--V--F--R--Q--K--R--S
CCAAAGCTGGCACAGAAGAAGCAATCGTGTATTCAGACATAGACCTGAAGAAGCTGGCTGAAATACGCCAGCAAATCCCCGTTTTTAGACAGAAGCGATC
                                            :::::::::.:::::::::::::::::::::::::..::::::: :::::::::::
--------------------------------------------CTGAAGAAGTTGGCTGAAATACGCCAGCAAATCCCTATTTTTAGCCAGAAGCGATC
---------------------------------------------L--K--K--L--A--E--I--R--Q--Q--I--P--I--F--S--Q--K--R--S

--------------------------------->
--D--L--Y--A--V--E--M--K--K--P--*-
AGACCTCTATGCTGTGGAGATGAAAAAGCCCTAA
:::::::::::: ::::::.::::::::::::::
AGACCTCTATGCAGTGGAGGTGAAAAAGCCCTAA
--D--L--Y--A--V--E--V--K--K--P--*-

Pig Consensus Sequence

>BGISUST0000879735
---------TTCCGCTTGGCACTggTCCAGCTTCACGTTTCTTCTGTCAAATCAGATAACCTCACTCGGGCTTGTGGCTTTATCCAGGAGGCAGCAAAGC
AAGGAGCCAAAATAATTTCGCTG---GAATGCTTTAATTCTCCATATGGCACGAAATATTTTCCGGAATATGCAGAGAAAATTCCTGGTGACTCCACGCA
GAAGCTGTCTGAAGTAGCAAAGGAGTGCGGCGTATATGTCATTGGA---TCCATTCCTGAAGAGGATGCCGGAAAATTATATAACACTTGTGCTGTATTT
GGGCCTGATGGAACTTTACTGGCAAAGTACAGAAAG---CATCTGTTTGACATTGATGTTCCTGGGAAAATCACATTTCAAGAATCTAAAACACTGAGTC
CTGGTGATAGTTTCTCCACATTTGATACT---TACTGCAGGGTGGGCCTGGGCATCTGCTACGACATCCGCTTTGCAGAGCTGGCACAAATCTATGCACA
GAGA---TGCCAGCTGTTAGTATATCCTGGAGCTTTTAATTTGACCACTGGACCAGCCCATTGGGAGCTGCTTCAGCGA------GCTGTTGATAATCAG
GTGTACGTGGCCACAGCATCTCCGGCCCGGGATGACAAAGCCTCCTATGTTGCCTGGGGACACAGCACCATTGTGAGTCCT-------------------
-----------------------------------------CTGAAGAAGTTGGCTGAAATACGCCAGCAAATCCCTATTTTTAGCCAGAAGCGATCAGA
CCTCTATGCAGTGGAGGTGAAAAAGCCCTAA


>BGISUSP0000879735
---FRLALVQLHVSSVKSDNLTRACGFIQEAAKQGAKIISL-ECFNSPYGTKYFPEYAEKIPGDSTQKLSEVAKECGVYVIG-SIPEEDAGKLYNTCAVF
GPDGTLLAKYRK-HLFDIDVPGKITFQESKTLSPGDSFSTFDT-YCRVGLGICYDIRFAELAQIYAQR-CQLLVYPGAFNLTTGPAHWELLQR--AVDNQ
VYVATASPARDDKASYVAWGHSTIVSP--------------------LKKLAEIRQQIPIFSQKRSDLYAVEVKKP*