Sequences
EST Library Info
jca1Joint capsule
Clusters
Oligos
SNPs

Gene ID ENSG00000105972 (click for geneview)
Transcript ID ENST00000265857(link to ensembl)
Symbol NP_057033.2
Localtion Chromosome:7:689432:709312:1 band: 7p22.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--A--A--A--M--A--E--Q--E--S--A--R--N--G--G--R--N--R--G--G--V--Q--R--V--E--G--K--L--R--A--S--
ATGGCGGCGGCGGCGGCGATGGCCGAGCAGGAGAGCGCCCGGAACGGCGGCCGCAACCGCGGCGGCGTCCAGCGTGTGGAGGGCAAGCTGCGCGCCAGCG
   ::::::::::: :::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::.::::::::::::.::::::::::::
---GCGGCGGCGGCTGCGATGGCCGAGCAGGAGAGCGCCCGGAACGGCGCCCGCAACCGCGGCGGCGTCCAGCGCGTGGAGGGCAAGTTGCGCGCCAGCG
----A--A--A--A--A--M--A--E--Q--E--S--A--R--N--G--A--R--N--R--G--G--V--Q--R--V--E--G--K--L--R--A--S--

------------------------------------------------------><--------------------------------------------
V--E--K--G--D--Y--Y--E--A--H--Q--M--Y--R--T--L--F--F--R--Y--M--S--Q--S--K--H--T--E--A--R--E--L--M--Y
TCGAGAAGGGCGACTACTACGAGGCGCACCAGATGTACCGGACCCTGTTCTTCAGGTACATGTCCCAGAGCAAGCACACGGAGGCCCGGGAGCTCATGTA
:::::::.::::::::.::::::::::::::::::::::::::::: ::::::   :::::::: ::::::::::::.: :::::::: ::::::::::.
TCGAGAAAGGCGACTATTACGAGGCGCACCAGATGTACCGGACCCTCTTCTTC---TACATGTCGCAGAGCAAGCACGCCGAGGCCCGCGAGCTCATGTG
V--E--K--G--D--Y--Y--E--A--H--Q--M--Y--R--T--L--F--F-----Y--M--S--Q--S--K--H--A--E--A--R--E--L--M--C

---------------------------------><-----------------------------------------------------------------
--S--G--A--L--L--F--F--S--H--G--Q--Q--N--S--A--A--D--L--S--M--L--V--L--E--S--L--E--K--A--E--V--E--V-
CTCGGGAGCCCTGCTCTTCTTCAGCCATGGCCAGCAAAACAGTGCAGCAGACTTGTCCATGCTGGTCCTGGAGTCCCTGGAGAAGGCGGAAGTGGAGGTG
::: :::::::::::::::::::::::.::::::::::::::.:: :: ::.:::::::::::::::.::::::: ::::::::::::::.:: ::::::
CTCCGGAGCCCTGCTCTTCTTCAGCCACGGCCAGCAAAACAGCGCCGCCGATTTGTCCATGCTGGTCTTGGAGTCACTGGAGAAGGCGGAGGTCGAGGTG
--S--G--A--L--L--F--F--S--H--G--Q--Q--N--S--A--A--D--L--S--M--L--V--L--E--S--L--E--K--A--E--V--E--V-

---------------><-----------------------------------------------------------------------------------
-A--D--E--L--L--E--N--L--A--K--V--F--S--L--M--D--P--N--S--P--E--R--V--T--F--V--S--R--A--L--K--W--S--
GCTGACGAGCTGCTGGAAAATCTGGCTAAAGTGTTCAGCCTGATGGACCCCAACTCTCCTGAGCGCGTGACCTTTGTGTCCAGAGCCCTGAAGTGGTCCA
::.:::::::::      :..::::: ::. ::::.:::.:::::::.::::::::.:: :::::::::.: ::::::::: ::::::::::::::::::
GCCGACGAGCTG------AGCCTGGCGAAGCTGTTTAGCTTGATGGATCCCAACTCCCCAGAGCGCGTGGCGTTTGTGTCCCGAGCCCTGAAGTGGTCCA
-A--D--E--L--------S--L--A--K--L--F--S--L--M--D--P--N--S--P--E--R--V--A--F--V--S--R--A--L--K--W--S--

--------------------------------------------------------------------><------------------------------
S--G--G--S--G--K--L--G-----H--P--R--L--H--Q--L--L--A--L--T--L--W--K--E--Q--N--Y--C--E--S--R--Y--H--F
GTGGGGGCTCCGGGAAGCTGGGC---CACCCCCGGCTGCACCAGCTGCTGGCCCTCACCCTGTGGAAAGAACAAAACTATTGTGAGTCGAGGTATCATTT
:.::.:: :: ::::::::::::   ::::::::::: :::::::::::::::::::: :::::::::   ::.:::::.::::::::  ::::.::.::
GCGGAGGATCGGGGAAGCTGGGCC--CACCCCCGGCTCCACCAGCTGCTGGCCCTCACGCTGTGGAAA---CAGAACTACTGTGAGTCCCGGTACCACTT
S--G--G--S--G--K--L--G--\--H--P--R--L--H--Q--L--L--A--L--T--L--W--K-----Q--N--Y--C--E--S--R--Y--H--F

----------------------------------------------------------------------------------------------------
--L--H--S--A--D--G--E--G--C--A--N--M--L--V--E--Y--S--T--S--R--G--F--R--S--E--V--D--M--F--V--A--Q--A-
TCTGCACTCAGCGGACGGGGAGGGCTGTGCCAACATGCTGGTGGAGTATTCCACGTCCCGCGGCTTCCGCAGCGAGGTGGACATGTTCGTGGCCCAGGCC
.:::::::: .  ::::::::.:::::.::::::::::::::::::::.::::::::::: :::::::::::::::::::::::::::::::::::::::
CCTGCACTCCAGCGACGGGGAAGGCTGCGCCAACATGCTGGTGGAGTACTCCACGTCCCGGGGCTTCCGCAGCGAGGTGGACATGTTCGTGGCCCAGGCC
--L--H--S--S--D--G--E--G--C--A--N--M--L--V--E--Y--S--T--S--R--G--F--R--S--E--V--D--M--F--V--A--Q--A-

-------><-------------------------------------------------------------------------------------------
-V--L--Q--F--L--C--L--K--N--K--S--S--A--S--V--V--F--T--T--Y--T--Q--K--H--P--S--I--E--D--G--P--P--F--
GTGCTACAGTTTCTCTGTTTAAAAAACAAAAGTAGCGCATCGGTGGTCTTCACGACGTACACCCAGAAGCACCCGTCCATCGAGGACGGGCCTCCGTTTG
::       ::::::::.::.::.:::::.::.:::::.:::::::: :::::::::::::: :::::::::::::::::::::.:::: ::.:::::.:
GTC------TTTCTCTGCTTGAAGAACAAGAGCAGCGCGTCGGTGGTGTTCACGACGTACACGCAGAAGCACCCGTCCATCGAGAACGGCCCCCCGTTCG
-V--------F--L--C--L--K--N--K--S--S--A--S--V--V--F--T--T--Y--T--Q--K--H--P--S--I--E--N--G--P--P--F--

------------------------------------------------><--------------------------------------------------
V--E--P--L--L--N--F--I--W--F--L--L--L--A--V--D--G--G--K--L--T--V--F--T--V--L--C--E--Q--Y--Q--P--S--L
TGGAGCCGCTGCTTAACTTCATCTGGTTCCTGCTGCTGGCTGTGGACGGTGGGAAGCTGACGGTGTTCACTGTGCTGTGTGAGCAGTACCAGCCATCCCT
:: :::: :::::.::::::::::::::.::::::.::::: : :::   :::::::::.:::::::::: :::::::::::::::::::::::.:: ::
TGCAGCCCCTGCTCAACTTCATCTGGTTTCTGCTGTTGGCTCTCGAC---GGGAAGCTGGCGGTGTTCACGGTGCTGTGTGAGCAGTACCAGCCGTCGCT
V--Q--P--L--L--N--F--I--W--F--L--L--L--A--L--D-----G--K--L--A--V--F--T--V--L--C--E--Q--Y--Q--P--S--L

------------------------><-----------------------------------------------------------------------><-
--R--R--D--P--M--Y--N--E--Y--L--D--R--I--G--Q--L--F--F--G--V--P--P--K--Q--T--S--S--Y--G--G--L--L--G-
CCGGCGGGACCCCATGTACAACGAGTACCTCGACCGCATAGGACAGCTGTTCTTCGGCGTCCCGCCCAAGCAGACGTCTTCCTACGGGGGCCTGCTCGGG
 :::::::::::::::::::::::::::::::::::::: :: ::::: :::::::: :: ::::::::::::::: :::: :::::.:::.::      
GCGGCGGGACCCCATGTACAACGAGTACCTCGACCGCATCGGCCAGCTCTTCTTCGGGGTGCCGCCCAAGCAGACGGCTTCGTACGGAGGCTTG------
--R--R--D--P--M--Y--N--E--Y--L--D--R--I--G--Q--L--F--F--G--V--P--P--K--Q--T--A--S--Y--G--G--L-------

-------------------------------------------------------------------------------------->
-N--L--L--T--S--L--M--G--S--S--E--Q--E--D--G--E--E--S--P--S--D--G--S--P--I--E--L--D--*-
AACCTTCTGACCAGCCTCATGGGCTCCTCAGAGCAGGAGGATGGGGAGGAGAGCCCCAGCGACGGCAGCCCCATCGAGCTGGACTGA
:::::::::: ::::::::::::::::::.:::::::::   :: ::::: ::.:  ..::::.::::::::::.::::: ::.:::
AACCTTCTGAGCAGCCTCATGGGCTCCTCGGAGCAGGAG---GGCGAGGACAGTCAGGACGACAGCAGCCCCATTGAGCTCGATTGA
-N--L--L--S--S--L--M--G--S--S--E--Q--E-----G--E--D--S--Q--D--D--S--S--P--I--E--L--D--*-

Pig Consensus Sequence

>BGISUST0000880938
---GCGGCGGCGGCTGCGATGGCCGAGCAGGAGAGCGCCCGGAACGGCGCCCGCAACCGCGGCGGCGTCCAGCGCGTGGAGGGCAAGTTGCGCGCCAGCG
TCGAGAAAGGCGACTATTACGAGGCGCACCAGATGTACCGGACCCTCTTCTTC---TACATGTCGCAGAGCAAGCACGCCGAGGCCCGCGAGCTCATGTG
CTCCGGAGCCCTGCTCTTCTTCAGCCACGGCCAGCAAAACAGCGCCGCCGATTTGTCCATGCTGGTCTTGGAGTCACTGGAGAAGGCGGAGGTCGAGGTG
GCCGACGAGCTG------AGCCTGGCGAAGCTGTTTAGCTTGATGGATCCCAACTCCCCAGAGCGCGTGGCGTTTGTGTCCCGAGCCCTGAAGTGGTCCA
GCGGAGGATCGGGGAAGCTGGGccACCCCCGGCTCCACCAGCTGCTGGCCCTCACGCTGTGGAAA---CAGAACTACTGTGAGTCCCGGTACCACTTCCT
GCACTCCAGCGACGGGGAAGGCTGCGCCAACATGCTGGTGGAGTACTCCACGTCCCGGGGCTTCCGCAGCGAGGTGGACATGTTCGTGGCCCAGGCCGTC
------TTTCTCTGCTTGAAGAACAAGAGCAGCGCGTCGGTGGTGTTCACGACGTACACGCAGAAGCACCCGTCCATCGAGAACGGCCCCCCGTTCGTGC
AGCCCCTGCTCAACTTCATCTGGTTTCTGCTGTTGGCTCTCGAC---GGGAAGCTGGCGGTGTTCACGGTGCTGTGTGAGCAGTACCAGCCGTCGCTGCG
GCGGGACCCCATGTACAACGAGTACCTCGACCGCATCGGCCAGCTCTTCTTCGGGGTGCCGCCCAAGCAGACGGCTTCGTACGGAGGCTTG------AAC
CTTCTGAGCAGCCTCATGGGCTCCTCGGAGCAGGAGGGCGAGGACAGTCAGGACGACAGCAGCCCCATTGAGCTCGATTGA


>BGISUSP0000880938
-AAAAAMAEQESARNGARNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFF-YMSQSKHAEARELMCSGALLFFSHGQQNSAADLSMLVLESLEKAEVEV
ADEL--SLAKLFSLMDPNSPERVAFVSRALKWSSGGSGKLGHPRLHQLLALTLWK-QNYCESRYHFLHSSDGEGCANMLVEYSTSRGFRSEVDMFVAQAV
--FLCLKNKSSASVVFTTYTQKHPSIENGPPFVQPLLNFIWFLLLALD-GKLAVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTASYGGL--N
LLSSLMGSSEQEGEDSQDDSSPIELD*