Sequences
EST Library Info
cut2Uterus - RNA from China
dbla1Unavailable
ebs3Foetus 50 days, brain stem
ecc3Foetus 50 days, cortex cerebri
eep2Foetus 50 days, epidermis
eye4Foetus 50 days, Eye
fat1Fatt
fcc4Unavailable
fce1Foetus 100 days, cerebellum
hyp2Hypothalamus
lin1Large intestine
lyg1Lymphatic gland
nje1Newborn 115 days, jejunum
pigcb1Unavailable
pliv2Unavailable
plun1Unavailable
ski1Skin
spc1Spinal cord
Clusters
Oligos
SNPs

Gene ID ENSG00000104549 (click for geneview)
Transcript ID ENST00000265896(link to ensembl)
Symbol SQLE
Localtion Chromosome:8:126079929:126103705:1 band: 8q24.13
Description Squalene monooxygenase (EC 1.14.99.7) (Squalene epoxidase) (SE). [Source:Uniprot/SWISSPROT;Acc:Q14534]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--W--T--F--L--G--I--A--T--F--T--Y--F--Y--K--K--F--G--D--F--I--T--L--A--N--R--E--V--L--L--C--V--L--
ATGTGGACTTTTCTGGGCATTGCCACTTTCACCTATTTTTATAAGAAGTTCGGGGACTTCATCACTTTGGCCAACAGGGAGGTCCTGTTGTGCGTGCTGG
::::::::.::::: :::::::::::.:::::.::::::::::::::.: ::::::::::.:: ::.:::::::::.:::: ::.::.:: :::::::::
ATGTGGACCTTTCTCGGCATTGCCACCTTCACTTATTTTTATAAGAAATGCGGGGACTTCGTCTCTCTGGCCAACAAGGAGCTCTTGCTGGGCGTGCTGG
-M--W--T--F--L--G--I--A--T--F--T--Y--F--Y--K--K--C--G--D--F--V--S--L--A--N--K--E--L--L--L--G--V--L--

----------------------------------------------------------------------------------------------------
V--F--L--S--L--G--L--V--L--S--Y--R--C--R--H--R--N--G--G--L--L--G--R--Q--Q--S--G--S--Q--F--A--L--F--S
TGTTCCTCTCGCTGGGCCTGGTGCTCTCCTACCGCTGTCGCCACCGAAACGGGGGTCTCCTCGGGCGCCAGCAGAGCGGCTCCCAGTTCGCCCTCTTCTC
:.::::: :::::::: :::::::: :::::::::::::::.::::.::.:::: .:::::::::::::::::::::::::::::::::::: :::::::
TATTCCTGTCGCTGGGGCTGGTGCTGTCCTACCGCTGTCGCTACCGGAATGGGGCCCTCCTCGGGCGCCAGCAGAGCGGCTCCCAGTTCGCCGTCTTCTC
V--F--L--S--L--G--L--V--L--S--Y--R--C--R--Y--R--N--G--A--L--L--G--R--Q--Q--S--G--S--Q--F--A--V--F--S

------------------------------------------------------------------------------------------><--------
--D--I--L--S--G--L--P--F--I--G--F--F--W--A--K--S--P--P--E--S--E--N--K--E--Q--L--E--A--R--R--R--R--K-
GGATATTCTCTCAGGCCTGCCTTTCATTGGCTTCTTCTGGGCCAAATCCCCCCCTGAATCAGAAAATAAGGAGCAGCTCGAGGCCAGGAGGCGCAGAAAA
::::::::: :::: :.::::::: ::::::::::::::::::::::::::: :::. :::::::: ::.::::::::.:.: :.::::::   :.:::.
GGATATTCTGTCAGCCTTGCCTTTAATTGGCTTCTTCTGGGCCAAATCCCCCACTGGTTCAGAAAAGAAAGAGCAGCTTGGGTCTAGGAGG---AAAAAG
--D--I--L--S--A--L--P--L--I--G--F--F--W--A--K--S--P--T--G--S--E--K--K--E--Q--L--G--S--R--R-----K--K-

----------------------------------------------------------------------------------------------------
-G--T--N--I--S--E--T--S--L--I--G--T--A--A--C--T--S--T--S--S--Q--N--D--P--E--V--I--I--V--G--A--G--V--
GGAACCAATATTTCAGAAACAAGCTTAATAGGAACAGCTGCCTGTACATCAACATCTTCTCAGAATGACCCAGAAGTTATCATCGTGGGAGCTGGCGTGC
::: :::::::::::::::::: ::::.:::::.::::::::: : :::..:.:::::::::::::::.::::::.:::::::::::::: ::::.::.:
GGATCCAATATTTCAGAAACAACCTTAGTAGGAGCAGCTGCCTCTCCATTGATATCTTCTCAGAATGATCCAGAAATTATCATCGTGGGATCTGGTGTAC
-G--S--N--I--S--E--T--T--L--V--G--A--A--A--S--P--L--I--S--S--Q--N--D--P--E--I--I--I--V--G--S--G--V--

----------------------------------------------------------------------------------------------------
L--G--S--A--L--A--A--V--L--S--R--D--G--R--K--V--T--V--I--E--R--D--L--K--E--P--D--R--I--V--G--E--F--L
TTGGCTCTGCTTTGGCAGCTGTGCTTTCCAGAGATGGAAGAAAGGTGACAGTCATTGAGAGAGACTTAAAAGAGCCTGACAGAATAGTTGGAGAATTCCT
::::::::::::::::.:: ::::: :::::::::::.:::::::::::::: :::::::::::.:::::::::::::::::.::: :.::::::: ..:
TTGGCTCTGCTTTGGCGGCGGTGCTGTCCAGAGATGGGAGAAAGGTGACAGTAATTGAGAGAGATTTAAAAGAGCCTGACAGGATACTCGGAGAATATTT
L--G--S--A--L--A--A--V--L--S--R--D--G--R--K--V--T--V--I--E--R--D--L--K--E--P--D--R--I--L--G--E--Y--L

-------------------------------------------><-------------------------------------------------------
--Q--P--G--G--Y--H--V--L--K--D--L--G--L--G--D--T--V--E--G--L--D--A--Q--V--V--N--G--Y--M--I--H--D--Q-
GCAGCCGGGTGGTTATCATGTTCTCAAAGACCTTGGTCTTGGAGATACAGTGGAAGGTCTTGATGCCCAGGTTGTAAATGGTTACATGATTCATGATCAG
::::::.::.::::.::::::.::.:::::::::::::::      :::.:::::::: :::::::::::::::::.::::.::::: ::::::::::::
GCAGCCAGGCGGTTGTCATGTCCTTAAAGACCTTGGTCTT------ACAATGGAAGGTATTGATGCCCAGGTTGTAGATGGCTACATCATTCATGATCAG
--Q--P--G--G--C--H--V--L--K--D--L--G--L--------T--M--E--G--I--D--A--Q--V--V--D--G--Y--I--I--H--D--Q-

----------------------------------------------------------------------------------------------------
-E--S--K--S--E--V--Q--I--P--Y--P--L--S--E--N--N--Q--V--Q--S--G--R--A--F--H--H--G--R--F--I--M--S--L--
GAAAGCAAATCAGAGGTTCAGATTCCTTACCCTCTGTCAGAAAACAATCAAGTGCAGAGTGGAAGAGCTTTCCATCACGGAAGATTCATCATGAGTCTCC
:::::::::::::::::::::::::::: ::::::.:::::::::::::: ::::::::::::::::::::::.:::.:::::::::::::::.::::::
GAAAGCAAATCAGAGGTTCAGATTCCTTTCCCTCTATCAGAAAACAATCACGTGCAGAGTGGAAGAGCTTTCCGTCATGGAAGATTCATCATGGGTCTCC
-E--S--K--S--E--V--Q--I--P--F--P--L--S--E--N--N--H--V--Q--S--G--R--A--F--R--H--G--R--F--I--M--G--L--

------------------------><-----------------------------------------------------------><-------------
R--K--A--A--M--A--E--P--N--A--K--F--I--E--G--V--V--L--Q--L--L--E--E--D--D--V--V--M--G--Q--Y--K--D--K
GGAAAGCAGCTATGGCAGAGCCCAATGCAAAGTTTATTGAAGGTGTTGTGTTACAGTTATTAGAGGAAGATGATGTTGTGATGGGGCAGTACAAGGATAA
::::.::::::::::::::::::   ::::::::::::::.::...::::.:.:::::::::::.::::: :::::.::  :::::              
GGAAGGCAGCTATGGCAGAGCCC---GCAAAGTTTATTGAGGGCACTGTGCTGCAGTTATTAGAAGAAGAGGATGTCGTTTTGGGG--------------
R--K--A--A--M--A--E--P-----A--K--F--I--E--G--T--V--L--Q--L--L--E--E--E--D--V--V--L--G---------------

------------------><--------------------------------------------------------------------------------
--E--T--G--D--I--K--E--L--H--A--P--L--T--V--V--A--D--G--L--F--S--K--F--R--K--S--L--V--S--N--K--V--S-
AGAGACTGGAGATATCAAGGAACTCCATGCTCCACTGACTGTTGTTGCAGATGGGCTTTTCTCCAAGTTCAGGAAAAGCCTGGTCTCCAATAAAGTTTCT
                   :::::::::::::::.:::::.::::.::::::::.:::::.:::::.::::::::::.::::.:::::::::::::::::
-------------------GAACTCCATGCTCCATTGACTATTGTCGCAGATGGACTTTTTTCCAAATTCAGGAAAAACCTGATCTCCAATAAAGTTTCT
--------------------E--L--H--A--P--L--T--I--V--A--D--G--L--F--S--K--F--R--K--N--L--I--S--N--K--V--S-

--------------------------------><------------------------------------------------------------------
-V--S--S--H--F--V--G--F--L--M--K--N--A--P--Q--F--K--A--N--H--A--E--L--I--L--A--N--P--S--P--V--L--I--
GTATCATCTCATTTTGTTGGCTTTCTTATGAAGAATGCACCACAGTTTAAAGCAAATCATGCTGAACTTATTTTAGCTAACCCGAGTCCAGTTCTCATCT
:: :: :::::::: :::::::::::::::.::               :::::::::::::::::::::.::::::::::.:::::::::::::::::::
GTTTCCTCTCATTTGGTTGGCTTTCTTATGGAG---------------AAAGCAAATCATGCTGAACTTGTTTTAGCTAATCCGAGTCCAGTTCTCATCT
-V--S--S--H--L--V--G--F--L--M--E-----------------K--A--N--H--A--E--L--V--L--A--N--P--S--P--V--L--I--

----------------------------------------------------------------------------------------------------
Y--Q--I--S--S--S--E--T--R--V--L--V--D--I--R--G--E--M--P--R--N--L--R--E--Y--M--V--E--K--I--Y--P--Q--I
ACCAGATTTCATCCAGTGAAACTCGAGTACTTGTTGACATTAGAGGAGAAATGCCAAGGAATTTAAGAGAATACATGGTTGAAAAAATTTACCCACAAAT
:::::::::::.:.::::::::::::::::::::::::::. :::::::::::::::::::::::::::::::::::.::::::: :::::::::::: :
ACCAGATTTCACCTAGTGAAACTCGAGTACTTGTTGACATCCGAGGAGAAATGCCAAGGAATTTAAGAGAATACATGATTGAAAACATTTACCCACAACT
Y--Q--I--S--P--S--E--T--R--V--L--V--D--I--R--G--E--M--P--R--N--L--R--E--Y--M--I--E--N--I--Y--P--Q--L

----><----------------------------------------------------------------------------------------------
--P--D--H--L--K--E--P--F--L--E--A--T--D--N--S--H--L--R--S--M--P--A--S--F--L--P--P--S--S--V--K--K--R-
ACCTGATCACCTGAAAGAACCATTCTTAGAAGCCACTGACAATTCTCATCTGAGGTCCATGCCAGCAAGCTTCCTTCCTCCTTCATCAGTGAAGAAACGA
::::   ::::::::::::::.:::::::::::: :: : :::::::::.::::.::::::::::::::::::::.:::.::::..::::.:: ::::::
ACCT---CACCTGAAAGAACCGTTCTTAGAAGCCTCTCAGAATTCTCATTTGAGATCCATGCCAGCAAGCTTCCTCCCTTCTTCGCCAGTAAATAAACGA
--P-----H--L--K--E--P--F--L--E--A--S--Q--N--S--H--L--R--S--M--P--A--S--F--L--P--S--S--P--V--N--K--R-

><--------------------------------------------------------------------------------------------------
-G--V--L--L--L--G--D--A--Y--N--M--R--H--P--L--T--G--G--G--M--T--V--A--F--K--D--I--K--L--W--R--K--L--
GGTGTTCTTCTTTTGGGAGACGCATATAATATGAGGCATCCACTTACTGGTGGAGGAATGACTGTTGCTTTTAAAGATATAAAACTATGGAGAAAACTGC
   :::::::::::::::::.:::.::::.::::::::::: ::.:: :: ::::::::::::::::::::::: :::::::::::.:::::::::.:::
---GTTCTTCTTTTGGGAGATGCACATAACATGAGGCATCCTCTCACGGGAGGAGGAATGACTGTTGCTTTTAATGATATAAAACTGTGGAGAAAATTGC
----V--L--L--L--G--D--A--H--N--M--R--H--P--L--T--G--G--G--M--T--V--A--F--N--D--I--K--L--W--R--K--L--

-------------------------------------------><-------------------------------------------------------
L--K--G--I--P--D--L--Y--D--D--A--A--I--F--E--A--K--K--S--F-----Y--W--A--R--K--T--S--H--S--F--V--V--N
TAAAGGGTATCCCTGACCTTTATGATGATGCAGCTATTTTCGAGGCCAAAAAATCATTT---TACTGGGCAAGAAAAACATCTCATTCCTTTGTCGTGAA
:::::::.::::::::::::::::::::::::::::::.:: ::::::::::::::::.   ::.:::.:::::::::..::::::::::::::.:::::
TAAAGGGCATCCCTGACCTTTATGATGATGCAGCTATTCTCCAGGCCAAAAAATCATTCT--TATTGGACAAGAAAAATGTCTCATTCCTTTGTTGTGAA
L--K--G--I--P--D--L--Y--D--D--A--A--I--L--Q--A--K--K--S--F--\--Y--W--T--R--K--M--S--H--S--F--V--V--N

-------------------------------------------><-------------------------------------------------------
--I--L--A--Q--A--L--Y--E--L--F--S--A--T--D--D--S--L--H--Q--L--R--K--A--C--F--L--Y--F--K--L--G--G--E-
TATCCTTGCTCAGGCTCTTTATGAATTATTTTCTGCCACAGATGATTCCCTGCATCAACTAAGAAAAGCCTGTTTTCTTTATTTCAAACTTGGTGGCGAA
:.:::::::::::::::: ::::::::::::::::::::::::   :: :::.:::::::::::::::::::::::.::::::::::::::::::: :::
TGTCCTTGCTCAGGCTCTATATGAATTATTTTCTGCCACAGAT---TCGCTGTATCAACTAAGAAAAGCCTGTTTTTTTTATTTCAAACTTGGTGGAGAA
--V--L--A--Q--A--L--Y--E--L--F--S--A--T--D-----S--L--Y--Q--L--R--K--A--C--F--F--Y--F--K--L--G--G--E-

-------------------------------><-------------------------------------------------------------------
-C--V--A--G--P--V--G--L--L--S--V--L--S--P--N--P--L--V--L--I--G--H--F--F--A--V--A--I--Y--A--V--Y--F--
TGTGTTGCGGGTCCTGTTGGGCTGCTTTCTGTATTGTCTCCTAACCCTCTAGTTTTAATTGGACACTTCTTTGCTGTTGCAATCTATGCCGTGTATTTTT
:::.::.  ::::: :::: :::: :::::   ::::::::.::.:::::.::::::::::::::::::::::::::::::.::::::::.. :::::::
TGTATTAGTGGTCCAGTTGCGCTGATTTCT---TTGTCTCCCAATCCTCTGGTTTTAATTGGACACTTCTTTGCTGTTGCAGTCTATGCCACCTATTTTT
-C--I--S--G--P--V--A--L--I--S-----L--S--P--N--P--L--V--L--I--G--H--F--F--A--V--A--V--Y--A--T--Y--F--

----------------------------------------------------------------------------------------------------
C--F--K--S--E--P--W--I--T--K--P--R--A--L--L--S--S--G--A--V--L--Y--K--A--C--S--V--I--F--P--L--I--Y--S
GCTTTAAGTCAGAACCTTGGATTACAAAACCTCGAGCCCTTCTCAGTAGTGGTGCTGTATTGTACAAAGCGTGTTCTGTAATATTTCCTCTAATTTACTC
:::::::.::.::.::.::::::::::::::::::::: :..::::::::::.::::::.::::::.:::.::::::::. ::::::::::.::::::::
GCTTTAAATCGGAGCCCTGGATTACAAAACCTCGAGCCATCTTCAGTAGTGGCGCTGTACTGTACAGAGCATGTTCTGTGTTATTTCCTCTGATTTACTC
C--F--K--S--E--P--W--I--T--K--P--R--A--I--F--S--S--G--A--V--L--Y--R--A--C--S--V--L--F--P--L--I--Y--S

------------------------>
--E--M--K--Y--M--V--H--*-
AGAAATGAAGTATATGGTTCATTAA
:::::: :::::. :::::::::::
AGAAATTAAGTACTTGGTTCATTAA
--E--I--K--Y--L--V--H--*-

Pig Consensus Sequence

>BGISUST0000878446
ATGTGGACCTTTCTCGGCATTGCCACCTTCACTTATTTTTATAAGAAATGCGGGGACTTCGTCTCTCTGGCCAACAAGGAGCTCTTGCTGGGCGTGCTGG
TATTCCTGTCGCTGGGGCTGGTGCTGTCCTACCGCTGTCGCTACCGGAATGGGGCCCTCCTCGGGCGCCAGCAGAGCGGCTCCCAGTTCGCCGTCTTCTC
GGATATTCTGTCAGCCTTGCCTTTAATTGGCTTCTTCTGGGCCAAATCCCCCACTGGTTCAGAAAAGAAAGAGCAGCTTGGGTCTAGGAGG---AAAAAG
GGATCCAATATTTCAGAAACAACCTTAGTAGGAGCAGCTGCCTCTCCATTGATATCTTCTCAGAATGATCCAGAAATTATCATCGTGGGATCTGGTGTAC
TTGGCTCTGCTTTGGCGGCGGTGCTGTCCAGAGATGGGAGAAAGGTGACAGTAATTGAGAGAGATTTAAAAGAGCCTGACAGGATACTCGGAGAATATTT
GCAGCCAGGCGGTTGTCATGTCCTTAAAGACCTTGGTCTT------ACAATGGAAGGTATTGATGCCCAGGTTGTAGATGGCTACATCATTCATGATCAG
GAAAGCAAATCAGAGGTTCAGATTCCTTTCCCTCTATCAGAAAACAATCACGTGCAGAGTGGAAGAGCTTTCCGTCATGGAAGATTCATCATGGGTCTCC
GGAAGGCAGCTATGGCAGAGCCC---GCAAAGTTTATTGAGGGCACTGTGCTGCAGTTATTAGAAGAAGAGGATGTCGTTTTGGGG--------------
-------------------GAACTCCATGCTCCATTGACTATTGTCGCAGATGGACTTTTTTCCAAATTCAGGAAAAACCTGATCTCCAATAAAGTTTCT
GTTTCCTCTCATTTGGTTGGCTTTCTTATGGAG---------------AAAGCAAATCATGCTGAACTTGTTTTAGCTAATCCGAGTCCAGTTCTCATCT
ACCAGATTTCACCTAGTGAAACTCGAGTACTTGTTGACATCCGAGGAGAAATGCCAAGGAATTTAAGAGAATACATGATTGAAAACATTTACCCACAACT
ACCT---CACCTGAAAGAACCGTTCTTAGAAGCCTCTCAGAATTCTCATTTGAGATCCATGCCAGCAAGCTTCCTCCCTTCTTCGCCAGTAAATAAACGA
---GTTCTTCTTTTGGGAGATGCACATAACATGAGGCATCCTCTCACGGGAGGAGGAATGACTGTTGCTTTTAATGATATAAAACTGTGGAGAAAATTGC
TAAAGGGCATCCCTGACCTTTATGATGATGCAGCTATTCTCCAGGCCAAAAAATCATTctATTGGACAAGAAAAATGTCTCATTCCTTTGTTGTGAATGT
CCTTGCTCAGGCTCTATATGAATTATTTTCTGCCACAGAT---TCGCTGTATCAACTAAGAAAAGCCTGTTTTTTTTATTTCAAACTTGGTGGAGAATGT
ATTAGTGGTCCAGTTGCGCTGATTTCT---TTGTCTCCCAATCCTCTGGTTTTAATTGGACACTTCTTTGCTGTTGCAGTCTATGCCACCTATTTTTGCT
TTAAATCGGAGCCCTGGATTACAAAACCTCGAGCCATCTTCAGTAGTGGCGCTGTACTGTACAGAGCATGTTCTGTGTTATTTCCTCTGATTTACTCAGA
AATTAAGTACTTGGTTCATTAA


>BGISUSP0000878446
MWTFLGIATFTYFYKKCGDFVSLANKELLLGVLVFLSLGLVLSYRCRYRNGALLGRQQSGSQFAVFSDILSALPLIGFFWAKSPTGSEKKEQLGSRR-KK
GSNISETTLVGAAASPLISSQNDPEIIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRILGEYLQPGGCHVLKDLGL--TMEGIDAQVVDGYIIHDQ
ESKSEVQIPFPLSENNHVQSGRAFRHGRFIMGLRKAAMAEP-AKFIEGTVLQLLEEEDVVLG-----------ELHAPLTIVADGLFSKFRKNLISNKVS
VSSHLVGFLME-----KANHAELVLANPSPVLIYQISPSETRVLVDIRGEMPRNLREYMIENIYPQLP-HLKEPFLEASQNSHLRSMPASFLPSSPVNKR
-VLLLGDAHNMRHPLTGGGMTVAFNDIKLWRKLLKGIPDLYDDAAILQAKKSFYWTRKMSHSFVVNVLAQALYELFSATD-SLYQLRKACFFYFKLGGEC
ISGPVALIS-LSPNPLVLIGHFFAVAVYATYFCFKSEPWITKPRAIFSSGAVLYRACSVLFPLIYSEIKYLVH*