Sequences
EST Library Info
ova3Ovary
Clusters
Oligos
SNPs

Gene ID ENSG00000120539 (click for geneview)
Transcript ID ENST00000265949(link to ensembl)
Symbol MASTL
Localtion Chromosome:10:27484298:27515854:1 band: 10p12.1
Description microtubule associated serine/threonine kinase-like [Source:RefSeq_peptide;Acc:NP_116233]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--P--T--A--G--S--K--K--E--P--G--G--G--A--A--T--E--E--G--V--N--R--I--A--V--P--K--P--P--S--I--E--
ATGGATCCCACCGCGGGAAGCAAGAAGGAGCCTGGAGGAGGCGCGGCGACTGAGGAGGGCGTGAATAGGATCGCAGTGCCAAAACCGCCCTCCATTGAGG
::::: :::::::: :: :::.:.: ::::  .::::::::::::::.::::.:::: :.:::: ::::::: :.::::: :.::: :: ::::::::::
ATGGAGCCCACCGCCGGCAGCGAAATGGAGAGCGGAGGAGGCGCGGCAACTGGGGAGTGTGTGACTAGGATCCCGGTGCCCAGACCTCCATCCATTGAGG
-M--E--P--T--A--G--S--E--M--E--S--G--G--G--A--A--T--G--E--C--V--T--R--I--P--V--P--R--P--P--S--I--E--

-------------------------------------------------------------------------------------><-------------
E--F--S--I--V--K--P--I--S--R--G--A--F--G--K--V--Y--L--G--Q--K--G--G--K--L--Y--A--V--K--V--V--K--K--A
AATTCAGCATAGTGAAGCCCATTAGCCGGGGCGCCTTCGGGAAAGTGTATCTGGGGCAGAAAGGCGGCAAATTGTATGCAGTAAAGGTTGTTAAAAAAGC
:.::.: :::::::::::::::.::::: ::::::::::::::.::::::::::::::::::::::.::..::::::::.::.:::            ::
AGTTTACCATAGTGAAGCCCATCAGCCGTGGCGCCTTCGGGAAGGTGTATCTGGGGCAGAAAGGCGACAGGTTGTATGCGGTGAAG------------GC
E--F--T--I--V--K--P--I--S--R--G--A--F--G--K--V--Y--L--G--Q--K--G--D--R--L--Y--A--V--K--------------A

----------------------------------------------------------------------------------------------------
--D--M--I--N--K--N--M--T--H--Q--V--Q--A--E--R--D--A--L--A--L--S--K--S--P--F--I--V--H--L--Y--Y--S--L-
AGACATGATCAACAAAAATATGACTCATCAGGTCCAAGCTGAGAGAGATGCACTGGCACTAAGCAAAAGCCCATTCATTGTCCATTTGTATTATTCACTG
::::::::::::::::::::::::::::::.:: :::::::::::.::::::::::: ::::::: :::.:: ::::::::.::::::::.::::::::.
AGACATGATCAACAAAAATATGACTCATCAAGTACAAGCTGAGAGGGATGCACTGGCCCTAAGCATAAGTCCTTTCATTGTTCATTTGTACTATTCACTA
--D--M--I--N--K--N--M--T--H--Q--V--Q--A--E--R--D--A--L--A--L--S--I--S--P--F--I--V--H--L--Y--Y--S--L-

--------------------------><------------------------------------------------------------------------
-Q--S--A-----N--N--V--Y--L--V--M--E--Y--L--I--G--G--D--V--K--S--L--L--H--I--Y--G--Y--F--D--E--E--M--
CAGTCTGCA---AACAATGTCTACTTGGTAATGGAATATCTTATTGGGGGAGATGTCAAGTCTCTCCTACATATATATGGTTATTTTGATGAAGAGATGG
::::: :::   :::::::: ::::::::::::::.:::::.::::: :::::::::::::::::::::::.::::::::::::.. : :::::: ::::
CAGTCAGCAA--AACAATGTATACTTGGTAATGGAGTATCTCATTGGTGGAGATGTCAAGTCTCTCCTACACATATATGGTTATCCAGCTGAAGACATGG
-Q--S--A--\--N--N--V--Y--L--V--M--E--Y--L--I--G--G--D--V--K--S--L--L--H--I--Y--G--Y--P--A--E--D--M--

------------------------------------------------------------------><--------------------------------
A--V--K--Y--I--S--E--V--A--L--A--L--D--Y--L--H--R--H--G--I--I--H--R--D--L--K--P--D--N--M--L--I--S--N
CTGTGAAATATATTTCTGAAGTAGCACTGGCTCTAGACTACCTTCACAGACATGGAATCATCCACAGGGACTTGAAACCGGACAATATGCTTATTTCTAA
::::::::::::::::::::::::::::::::                                    ::.::::::::.::: ::::::::::::::::
CTGTGAAATATATTTCTGAAGTAGCACTGGCT------------------------------------GATTTGAAACCAGACTATATGCTTATTTCTAA
A--V--K--Y--I--S--E--V--A--L--A--------------------------------------D--L--K--P--D--Y--M--L--I--S--N

-------------------------------------------------------><-------------------------------------------
--E--G--H--I--K--L--T--D--F--G--L--S--K--V--T--L--N--R--D--I--N--M--M--D--I--L--T--T--P--S--M--A--K-
TGAGGGTCATATTAAACTGACGGATTTTGGCCTTTCAAAAGTTACTTTGAATAGAGATATTAATATGATGGATATCCTTACAACACCATCAATGGCAAAA
.::.::::::::::::::.::.:::::::::::::: ::::::::::::::::::                                             
CGAAGGTCATATTAAACTAACAGATTTTGGCCTTTCCAAAGTTACTTTGAATAGA---------------------------------------------
--E--G--H--I--K--L--T--D--F--G--L--S--K--V--T--L--N--R----------------------------------------------

--------------------------------------------------------------><------------------------------------
-P--R--Q--D--Y--S--R--T--P--G--Q--V--L--S--L--I--S--S--L--G--F--N--T--P--I--A--E--K--N--Q--D--P--A--
CCTAGACAAGATTATTCAAGAACCCCAGGACAAGTGTTATCGCTTATCAGCTCGTTGGGATTTAACACACCAATTGCAGAAAAAAATCAAGACCCTGCAA
         ::.:::::::::::::::::::::::.::::: ::.:::::.:: :::::::::   ::::::.::::::::::::::: :::::::::::
---------GACTATTCAAGAACCCCAGGACAAGTATTATCTCTCATCAGTTCTTTGGGATTT---ACACCAGTTGCAGAAAAAAATCTAGACCCTGCAA
----------D--Y--S--R--T--P--G--Q--V--L--S--L--I--S--S--L--G--F-----T--P--V--A--E--K--N--L--D--P--A--

----------------------------------------------------------------------------------------------------
N--I--L--S--A--C--L--S--E--T--S--Q--L--S--Q--G--L--V--C--P--M--S--V--D--Q--K--D--T--T--P--Y--S-----S
ACATCCTTTCAGCCTGTCTGTCTGAAACATCACAGCTTTCTCAAGGACTCGTATGCCCTATGTCTGTAGATCAAAAGGACACTACGCCTTATTCT---AG
:.::.::::::.:...: ..::::::::::::::::::::::::::::: .. ::.:::::::::.:::::::::::::.:.::: :::::::::   ..
ATATTCTTTCAACTCATGCATCTGAAACATCACAGCTTTCTCAAGGACTAACTTGTCCTATGTCTATAGATCAAAAGGATATTACTCCTTATTCTA--GA
N--I--L--S--T--H--A--S--E--T--S--Q--L--S--Q--G--L--T--C--P--M--S--I--D--Q--K--D--I--T--P--Y--S--\--S

----------------><----------------------------------------------------------------------------------
--K--L--L--K--S--C--L--E--T--V--A--S--N--P--G--M--P--V--K--C--L--T--S--N--L--L--Q--S--R--K--R--L--A-
CAAATTACTAAAATCATGTCTTGAAACAGTTGCCTCCAACCCAGGAATGCCTGTGAAGTGTCTAACTTCTAATTTACTCCAGTCTAGGAAAAGGCTGGCC
::::.:.:::::::::   :::::::::::::::::: ::::: ..::::::::.::::::::.:::::. ::.:::::::::: :::::.::::: :: 
CAAACTGCTAAAATCA---CTTGAAACAGTTGCCTCCCACCCACAGATGCCTGTAAAGTGTCTGACTTCCCATCTACTCCAGTCGAGGAAGAGGCTTGCA
--K--L--L--K--S-----L--E--T--V--A--S--H--P--Q--M--P--V--K--C--L--T--S--H--L--L--Q--S--R--K--R--L--A-

-----------------------------------------------------------------------------------------><---------
-T--S--S--A--S--S--Q--S--H--T--F--I--S--S--V--E--S--E--C--H--S--S--P--K--W--E--K--D--C--Q--E--S--D--
ACATCCAGTGCCAGTAGTCAATCCCACACCTTCATATCCAGTGTGGAATCAGAATGCCACAGCAGTCCCAAATGGGAAAAAGATTGCCAGGAAAGTGATG
::::::::..::::.:::::.:::::::::::::: ::.::::::::::: :: ::::::::::::::::.:::::::::.:::::::::          
ACATCCAGCACCAGCAGTCAGTCCCACACCTTCATCTCTAGTGTGGAATCCGACTGCCACAGCAGTCCCAGATGGGAAAAGGATTGCCAG----------
-T--S--S--T--S--S--Q--S--H--T--F--I--S--S--V--E--S--D--C--H--S--S--P--R--W--E--K--D--C--Q-----------

----------------------------------------------------------------------------------------------------
E--A--L--G--P--T--M--M--S--W--N--A--V--E--K--L--C--A--K--S--A--N--A--I--E--T--K--G--F--N--K--K--D--L
AAGCATTGGGCCCAACAATGATGAGTTGGAATGCAGTTGAAAAGTTATGCGCAAAATCTGCAAATGCCATTGAGACGAAAGGTTTCAATAAAAAGGATCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--L--A--L--S--P--I--H--N--S--S--A--L--P--T--T--G--R--S--C--V--N--L--A--K--K--C--F--S--G--E--V--S-
GGAGTTAGCTCTTTCTCCCATTCATAACAGCAGTGCCCTTCCCACCACTGGACGCTCTTGTGTAAACCTTGCTAAAAAATGCTTCTCTGGGGAAGTTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-W--E--A--V--E--L--D--V--N--N--I--N--M--D--T--D--T--S--Q--L--G--F--H--Q--S--N--Q--W--A--V--D--S--G--
TGGGAAGCAGTAGAACTGGATGTAAATAATATAAATATGGACACTGACACAAGTCAGTTAGGTTTCCATCAGTCAAATCAGTGGGCTGTGGATTCTGGTG
                                                                     :::::: .:::::::.::::::::::..:::
---------------------------------------------------------------------CAGTCACGTCAGTGGACTGTGGATTCCAGTG
----------------------------------------------------------------------Q--S--R--Q--W--T--V--D--S--S--

----------------------------------------------------------------------------------------------------
G--I--S--E--E--H--L--G--K--R--S--L--K--R--N--F--E--L--V--D--S--S--P--C--K-----K--I--I--Q--N--K--K--T
GGATATCTGAAGAGCACCTTGGGAAAAGAAGTTTAAAAAGAAATTTTGAGTTGGTTGACTCCAGTCCTTGTAAA---AAAATTATACAGAATAAAAAAAC
::::: :::::::::::::::::::::::::::  :::::::.:::::::::..:::::::::::::::::      :::::::: ::::::::::::: 
GGATAACTGAAGAGCACCTTGGGAAAAGAAGTTGTAAAAGAAGTTTTGAGTTAATTGACTCCAGTCCTTGT---C--AAAATTATCCAGAATAAAAAAAA
G--I--T--E--E--H--L--G--K--R--S--C--K--R--S--F--E--L--I--D--S--S--P--C-----\--K--I--I--Q--N--K--K--N

----------------------------------------------------------------------------------------------------
--C--V--E--Y--K--H-----N--E--M--T--N--C--Y--T--N--Q--N--T--G--L--T--V--E--V--Q--D--L--K--L--S--V--H-
TTGTGTAGAGTATAAGCAT---AACGAAATGACAAATTGTTATACAAATCAAAATACAGGCTTAACAGTTGAAGTGCAGGACCTTAAGCTATCAGTGCAC
::::::::::::::::::.   ::.::::::: :.:.:::::.::::::::::. ::::::: ::::..:::::: ::::::::::::::.::.:::.: 
TTGTGTAGAGTATAAGCACAGTAATGAAATGAAAGACTGTTACACAAATCAAAGGACAGGCTGAACAACTGAAGTCCAGGACCTTAAGCTGTCGGTGTAG
--C--V--E--Y--K--H--S--N--E--M--K--D--C--Y--T--N--Q--R--T--G--*--T--T--E--V--Q--D--L--K--L--S--V--*-

----------------------------------------------------------------------------------------------------
-K--S--Q--Q--N--D--C--A--N--K--E--N--I--V--N--S--F--T--D--K--Q--Q--T--P--E--K--L--P--I--P--M--I--A--
AAAAGTCAACAAAATGACTGTGCTAATAAGGAGAACATTGTCAATTCTTTTACTGATAAACAACAAACACCAGAAAAATTACCTATACCAATGATAGCAA
..:..:::.:::::.::::::::::::::::::::::: : :::: :::::: ::::::::::::::: :::::.::.:.:::::: :::::::::::::
GGAGATCAGCAAAACGACTGTGCTAATAAGGAGAACATGGGCAATACTTTTAGTGATAAACAACAAACCCCAGAGAAGTCACCTATCCCAATGATAGCAA
-G--D--Q--Q--N--D--C--A--N--K--E--N--M--G--N--T--F--S--D--K--Q--Q--T--P--E--K--S--P--I--P--M--I--A--

----------------------------------------------------------------------------------------------------
K--N--L--M--C--E--L--D--E--D--C--E--K--N--S--K--R--D--Y--L--S--S--S--F--L--C--S--D--D--D--R--A--S--K
AAAACCTTATGTGTGAACTCGATGAAGACTGTGAAAAGAATAGTAAGAGGGACTACTTAAGTTCTAGTTTTCTATGTTCTGATGATGATAGAGCTTCTAA
:::::::.::::::::::: ::::: ::. :::: :::::::::::::.:::::::::::::::::::::::::::::::::::::::::::.::.::::
AAAACCTCATGTGTGAACTGGATGATGATGGTGACAAGAATAGTAAGAAGGACTACTTAAGTTCTAGTTTTCTATGTTCTGATGATGATAGAACTCCTAA
K--N--L--M--C--E--L--D--D--D--G--D--K--N--S--K--K--D--Y--L--S--S--S--F--L--C--S--D--D--D--R--T--P--K

----------------------------------------------------------------------------------------------------
--N--I--S--M--N--S--D--S--S--F--P--G--I--S--I--M--E--S--P--L--E--S--Q--P--L--D--S--D--R--S--I--K--E-
AAATATTTCTATGAACTCTGATTCATCTTTTCCTGGAATTTCTATAATGGAAAGTCCATTAGAAAGTCAGCCCTTAGATTCAGATAGAAGCATCAAAGAA
::.::::. .:::.::::::::::::::::.::::: :::::.::.::::::::::::::::.::: :::.::::::::.::::::.:::::::::::::
AAGTATTCACATGGACTCTGATTCATCTTTCCCTGGCATTTCCATGATGGAAAGTCCATTAGGAAGGCAGTCCTTAGATCCAGATAAAAGCATCAAAGAA
--S--I--H--M--D--S--D--S--S--F--P--G--I--S--M--M--E--S--P--L--G--R--Q--S--L--D--P--D--K--S--I--K--E-

----------------------------------------------------------------------------------------------------
-S--S--F--E--E--S--N--I--E--D--P--L--I--V--T--P--D--C--Q--E--K--T--S--P--K--G--V--E--N--P--A--V--Q--
TCCTCTTTTGAAGAATCAAATATTGAAGATCCACTTATTGTAACACCAGATTGCCAAGAAAAGACCTCACCAAAAGGTGTCGAGAACCCTGCTGTACAAG
:::::::: ::::..::::: ::::::::.:. ::  .:..: :.:: ...:::::::::.. :::...:.::.:::.: .:::::.:::::.   ::::
TCCTCTTTGGAAGGGTCAAAAATTGAAGACCTCCTGCCTACATCGCCCAGCTGCCAAGAAGGTACCCTGCTAAGAGGCGATGAGAATCCTGCCCACCAAG
-S--S--L--E--G--S--K--I--E--D--L--L--P--T--S--P--S--C--Q--E--G--T--L--L--R--G--D--E--N--P--A--H--Q--

----------------------------------------------------------------------------------------------------
E--S--N--Q--K--M--L--G--P--P--L--E--V--L--K--T--L--A--S--K--R--N--A--V--A--F--R--S--F--N--S--H--I--N
AGAGTAACCAAAAAATGTTAGGTCCTCCTTTGGAGGTGCTGAAAACGTTAGCCTCTAAAAGAAATGCTGTTGCTTTTCGAAGTTTTAACAGTCATATTAA
: :: :::: ::::::::::: ::::.:::..::.:::.:::::::. ::.:::::::::::::::: :: ::.:::::.::::::::::::::::::::
ACAGAAACCCAAAAATGTTAGCTCCTTCTTCAGAAGTGTTGAAAACAATAACCTCTAAAAGAAATGCGGTGGCCTTTCGGAGTTTTAACAGTCATATTAA
D--R--N--P--K--M--L--A--P--S--S--E--V--L--K--T--I--T--S--K--R--N--A--V--A--F--R--S--F--N--S--H--I--N

----------------------------------------------------------------------------------------------------
--A--S--N--N--S--E--P--S--R--M--N--M--T--S--L--D--A--M--D--I--S--C--A--Y--S--G--S--Y--P--M--A--I--T-
TGCATCCAATAACTCAGAACCATCCAGAATGAACATGACTTCTTTAGATGCAATGGATATTTCGTGTGCCTACAGTGGTTCATATCCCATGGCTATAACC
:::::::: .:.:::::::::.::::.:                                                                        
TGCATCCACCAGCTCAGAACCGTCCAAA------------------------------------------------------------------------
--A--S--T--S--S--E--P--S--K-------------------------------------------------------------------------

-----------------------------------><---------------------------------------------------------------
-P--T--Q--K--R--R--S--C--M--P--H--Q--T--P--N--Q--I--K--S--G--T--P--Y--R--T--P--K--S--V--R--R--G--V--
CCTACTCAAAAAAGAAGATCCTGTATGCCACATCAGACCCCAAATCAGATCAAGTCGGGAACTCCATACCGAACTCCGAAGAGTGTGAGAAGAGGGGTGG
                                                         :::::::::::: :::::::.:::::::::::::::::.:..:
---------------------------------------------------------GGAACTCCATACAGAACTCCAAAGAGTGTGAGAAGAGGAGCAG
----------------------------------------------------------G--T--P--Y--R--T--P--K--S--V--R--R--G--A--

--------------------------------------------------------------------------><------------------------
A--P--V--D--D--G--R--I--L--G--T--P--D--Y--L--A--P--E--L--L--L--G--R--A--H--G--P--A--V--D--W--W--A--L
CCCCCGTTGATGATGGGCGAATTCTAGGAACCCCAGACTACCTTGCACCTGAGCTGTTACTAGGCAGGGCCCATGGTCCTGCGGTAGACTGGTGGGCACT
:::: :: :::::::::::::::::.:::::::: ::::::::.::::::::::::.::.::::::::.:::::                          
CCCCAGTGGATGATGGGCGAATTCTGGGAACCCCTGACTACCTCGCACCTGAGCTGCTATTAGGCAGGACCCAT--------------------------
A--P--V--D--D--G--R--I--L--G--T--P--D--Y--L--A--P--E--L--L--L--G--R--T--H---------------------------

----------------------------------------------------------------------------------------><----------
--G--V--C--L--F--E--F--L--T--G--I--P--P--F--N--D--E--T--P--Q--Q--V--F--Q--N--I--L--K--R--D--I--P--W-
TGGAGTTTGCTTGTTTGAATTTCTAACAGGAATTCCCCCTTTCAATGATGAAACACCACAACAAGTATTCCAGAATATTCTGAAAAGAGATATCCCTTGG
                            ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::
----------------------------GGAATTCCCCCTTTCAATGATGAAACACCACAACAAGTATTCCAGAATATTCTGAAAAGA---ATCCCTTGG
-----------------------------G--I--P--P--F--N--D--E--T--P--Q--Q--V--F--Q--N--I--L--K--R-----I--P--W-

------------------------------------------------------------------------------------------><--------
-P--E--G--E--E--K--L--S--D--N--A--Q--S--A--V--E--I--L--L--T--I--D--D--T--K--R--A--G--M--K--E--L--K--
CCAGAAGGTGAAGAAAAGTTATCTGATAATGCTCAAAGTGCAGTAGAAATACTTTTAACCATTGATGATACAAAGAGAGCTGGAATGAAAGAGCTAAAAC
:: ::::::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::::::::::   ::.::::
CCTGAAGGTGAAGAAAAGTTATCTGATAATGCTCAAAGTGCAGTAGAGATACTCTTAACCATTGATGATACAAAGAGAGCTGGAATGAAA---CTGAAAC
-P--E--G--E--E--K--L--S--D--N--A--Q--S--A--V--E--I--L--L--T--I--D--D--T--K--R--A--G--M--K-----L--K--

----------------------------------------------------------------------------------------------------
R--H--P--L--F--S--D--V--D--W--E--N--L--Q--H--Q--T--M--P--F--I--P--Q--P--D--D--E--T--D--T--S--Y--F--E
GTCATCCTCTCTTCAGTGATGTGGACTGGGAAAATCTGCAGCATCAGACTATGCCTTTCATCCCCCAGCCAGATGATGAAACAGATACCTCCTATTTTGA
.::::::::::::::.:::.:::::::::::::::::.:::::.::.:::::::::::::: :::::.:::::::::::::::::::: ::.::::::::
ATCATCCTCTCTTCAATGACGTGGACTGGGAAAATCTACAGCACCAAACTATGCCTTTCATACCCCAACCAGATGATGAAACAGATACATCTTATTTTGA
H--H--P--L--F--N--D--V--D--W--E--N--L--Q--H--Q--T--M--P--F--I--P--Q--P--D--D--E--T--D--T--S--Y--F--E

------------------------------------------------>
--A--R--N--T--A--Q--H--L--T--V--S--G--F--S--L--*-
AGCCAGGAATACTGCTCAGCACCTGACTGTATCTGGATTTAGTCTGTAG
::::::::::::::::::::::::::: :: :::::::::::.::.   
AGCCAGGAATACTGCTCAGCACCTGACAGTTTCTGGATTTAGCCTA---
--A--R--N--T--A--Q--H--L--T--V--S--G--F--S--L----

Pig Consensus Sequence

>BGISUST0000881339
ATGGAGCCCACCGCCGGCAGCGAAATGGAGAGCGGAGGAGGCGCGGCAACTGGGGAGTGTGTGACTAGGATCCCGGTGCCCAGACCTCCATCCATTGAGG
AGTTTACCATAGTGAAGCCCATCAGCCGTGGCGCCTTCGGGAAGGTGTATCTGGGGCAGAAAGGCGACAGGTTGTATGCGGTGAAG------------GC
AGACATGATCAACAAAAATATGACTCATCAAGTACAAGCTGAGAGGGATGCACTGGCCCTAAGCATAAGTCCTTTCATTGTTCATTTGTACTATTCACTA
CAGTCAGCaaACAATGTATACTTGGTAATGGAGTATCTCATTGGTGGAGATGTCAAGTCTCTCCTACACATATATGGTTATCCAGCTGAAGACATGGCTG
TGAAATATATTTCTGAAGTAGCACTGGCT------------------------------------GATTTGAAACCAGACTATATGCTTATTTCTAACGA
AGGTCATATTAAACTAACAGATTTTGGCCTTTCCAAAGTTACTTTGAATAGA------------------------------------------------
------GACTATTCAAGAACCCCAGGACAAGTATTATCTCTCATCAGTTCTTTGGGATTT---ACACCAGTTGCAGAAAAAAATCTAGACCCTGCAAATA
TTCTTTCAACTCATGCATCTGAAACATCACAGCTTTCTCAAGGACTAACTTGTCCTATGTCTATAGATCAAAAGGATATTACTCCTTATTCtgACAAACT
GCTAAAATCA---CTTGAAACAGTTGCCTCCCACCCACAGATGCCTGTAAAGTGTCTGACTTCCCATCTACTCCAGTCGAGGAAGAGGCTTGCAACATCC
AGCACCAGCAGTCAGTCCCACACCTTCATCTCTAGTGTGGAATCCGACTGCCACAGCAGTCCCAGATGGGAAAAGGATTGCCAG----------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------CAGTCACGTCAGTGGACTGTGGATTCCAGTGGGATAA
CTGAAGAGCACCTTGGGAAAAGAAGTTGTAAAAGAAGTTTTGAGTTAATTGACTCCAGTCCTTGtaAAATTATCCAGAATAAAAAAAATTGTGTAGAGTA
TAAGCACAGTAATGAAATGAAAGACTGTTACACAAATCAAAGGACAGGCTGAACAACTGAAGTCCAGGACCTTAAGCTGTCGGTGTAGGGAGATCAGCAA
AACGACTGTGCTAATAAGGAGAACATGGGCAATACTTTTAGTGATAAACAACAAACCCCAGAGAAGTCACCTATCCCAATGATAGCAAAAAACCTCATGT
GTGAACTGGATGATGATGGTGACAAGAATAGTAAGAAGGACTACTTAAGTTCTAGTTTTCTATGTTCTGATGATGATAGAACTCCTAAAAGTATTCACAT
GGACTCTGATTCATCTTTCCCTGGCATTTCCATGATGGAAAGTCCATTAGGAAGGCAGTCCTTAGATCCAGATAAAAGCATCAAAGAATCCTCTTTGGAA
GGGTCAAAAATTGAAGACCTCCTGCCTACATCGCCCAGCTGCCAAGAAGGTACCCTGCTAAGAGGCGATGAGAATCCTGCCCACCAAGACAGAAACCCAA
AAATGTTAGCTCCTTCTTCAGAAGTGTTGAAAACAATAACCTCTAAAAGAAATGCGGTGGCCTTTCGGAGTTTTAACAGTCATATTAATGCATCCACCAG
CTCAGAACCGTCC---------------------------------------------------------------------------------------
------------------------------------------GGAACTCCATACAGAACTCCAAAGAGTGTGAGAAGAGGAGCAGCCCCAGTGGATGATG
GGCGAATTCTGGGAACCCCTGACTACCTCGCACCTGAGCTGCTATTAGGCAGGACCCAT-----------------------------------------
-------------GGAATTCCCCCTTTCAATGATGAAACACCACAACAAGTATTCCAGAATATTCTGAAAAGA---ATCCCTTGGCCTGAAGGTGAAGAA
AAGTTATCTGATAATGCTCAAAGTGCAGTAGAGATACTCTTAACCATTGATGATACAAAGAGAGCTGGAATGAAA---CTGAAACATCATCCTCTCTTCA
ATGACGTGGACTGGGAAAATCTACAGCACCAAACTATGCCTTTCATACCCCAACCAGATGATGAAACAGATACATCTTATTTTGAAGCCAGGAATACTGC
TCAGCACCTGACAGTTTCTGGATTTAGCCTA---


>BGISUSP0000881339
MEPTAGSEMESGGGAATGECVTRIPVPRPPSIEEFTIVKPISRGAFGKVYLGQKGDRLYAVK----ADMINKNMTHQVQAERDALALSISPFIVHLYYSL
QSANNVYLVMEYLIGGDVKSLLHIYGYPAEDMAVKYISEVALA------------DLKPDYMLISNEGHIKLTDFGLSKVTLNR----------------
--DYSRTPGQVLSLISSLGF-TPVAEKNLDPANILSTHASETSQLSQGLTCPMSIDQKDITPYSDKLLKS-LETVASHPQMPVKCLTSHLLQSRKRLATS
STSSQSHTFISSVESDCHSSPRWEKDCQ------------------------------------------------------------------------
---------------------QSRQWTVDSSGITEEHLGKRSCKRSFELIDSSPCKIIQNKKNCVEYKHSNEMKDCYTNQRTG*TTEVQDLKLSV*GDQQ
NDCANKENMGNTFSDKQQTPEKSPIPMIAKNLMCELDDDGDKNSKKDYLSSSFLCSDDDRTPKSIHMDSDSSFPGISMMESPLGRQSLDPDKSIKESSLE
GSKIEDLLPTSPSCQEGTLLRGDENPAHQDRNPKMLAPSSEVLKTITSKRNAVAFRSFNSHINASTSSEPS-----------------------------
--------------GTPYRTPKSVRRGAAPVDDGRILGTPDYLAPELLLGRTH------------------GIPPFNDETPQQVFQNILKR-IPWPEGEE
KLSDNAQSAVEILLTIDDTKRAGMK-LKHHPLFNDVDWENLQHQTMPFIPQPDDETDTSYFEARNTAQHLTVSGFSL-