Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000096474 (click for geneview)
Transcript ID ENST00000266123(link to ensembl)
Symbol MSH5
Localtion Chromosome:6:31815756:31840601:1 band: 6p21.33
Description MutS protein homolog 5. [Source:Uniprot/SWISSPROT;Acc:O43196]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--S--L--G--A--N--P--R--R--T--P--Q--G--P--R--P--G--A--A--S--S--G--F--P--S--P--A--P--V--P--G--P--
ATGGCCTCCTTAGGAGCGAACCCAAGGAGGACACCGCAGGGACCGAGACCTGGGGCGGCCTCCTCCGGCTTCCCCAGCCCGGCCCCAGTGCCGGGCCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
R--E--A--E--E--E--E--V--E--E--E--E--E--L--A--E--I--H--L--C--V--L--W--N--S--G--Y--L--G--I--A--Y--Y--D
GGGAGGCCGAGGAGGAGGAAGTCGAGGAGGAGGAGGAGCTGGCCGAGATCCATCTGTGTGTGCTGTGGAATTCAGGATACTTGGGCATTGCCTACTATGA
                                               ::.:::::::::::::::::::::::::::.::.:::::::::::::::::::
-----------------------------------------------ATTCATCTGTGTGTGCTGTGGAATTCAGGACACCTGGGCATTGCCTACTATGA
------------------------------------------------I--H--L--C--V--L--W--N--S--G--H--L--G--I--A--Y--Y--D

----------------------------------------------------------------------><----------------------------
--T--S--D--S--T--I--H--F--M--P--D--A--P--D--H--E--S--L--K--L--L--Q--R--V--L--D--E--I--N--P--Q--S--V-
TACTAGTGACTCCACTATCCACTTCATGCCAGATGCCCCAGACCACGAGAGCCTCAAGCTTCTCCAGAGAGTTCTGGATGAGATCAATCCCCAGTCTGTT
.:::.::::::::::.:::::::::::::::::::::::::::::.:::::::::::::: :: ::::::   ::::::::.:::::::::: :::::::
CACTGGTGACTCCACCATCCACTTCATGCCAGATGCCCCAGACCATGAGAGCCTCAAGCTGCTGCAGAGA---CTGGATGAAATCAATCCCCTGTCTGTT
--T--G--D--S--T--I--H--F--M--P--D--A--P--D--H--E--S--L--K--L--L--Q--R-----L--D--E--I--N--P--L--S--V-

---------------------------------------------------><-----------------------------------------------
-V--T--S--A--K--Q--D--E--N--M--T--R--F--L--G--K--L--A--S--Q--E--H--R--E--P--K--R--P--E--I--I--F--L--
GTTACGAGTGCCAAACAGGATGAGAATATGACTCGATTTCTGGGAAAGCTTGCCTCCCAGGAGCACAGAGAGCCTAAAAGACCTGAAATCATATTTTTGC
::::: ::.:::::::::::::::::::::::.::::::::::::::::::   :::::::: ::::::: ::::::.:::::::::::..:::::::::
GTTACCAGCGCCAAACAGGATGAGAATATGACCCGATTTCTGGGAAAGCTT---TCCCAGGATCACAGAGCGCCTAAGAGACCTGAAATTGTATTTTTGC
-V--T--S--A--K--Q--D--E--N--M--T--R--F--L--G--K--L-----S--Q--D--H--R--A--P--K--R--P--E--I--V--F--L--

--------------><------------------------------------------------------------------------------------
P--S--V--D--F--G--L--E--I--S--K--Q--R--L--L--S--G--N--Y--S--F--I--P--D--A--M--T--A--T--E--K--I--L--F
CAAGTGTGGATTTTGGTCTGGAGATAAGCAAACAACGCCTCCTTTCTGGAAACTACTCCTTCATCCCAGACGCCATGACTGCCACTGAGAAAATCCTCTT
::::::::::::::   :::::::::::::::::.::::: :::::::::::.:::::::::::::: ::: ::::::::::::::::::::::::::::
CAAGTGTGGATTTT---CTGGAGATAAGCAAACAGCGCCTGCTTTCTGGAAATTACTCCTTCATCCCTGACTCCATGACTGCCACTGAGAAAATCCTCTT
P--S--V--D--F-----L--E--I--S--K--Q--R--L--L--S--G--N--Y--S--F--I--P--D--S--M--T--A--T--E--K--I--L--F

------------------------------------><--------------------------------------------------------------
--L--S--S--I--I--P--F--D--C--L--L--T--V--R--A--L--G--G--L--L--K--F--L--G--R--R--R--I--G--V--E--L--E-
CCTCTCTTCCATTATTCCCTTTGACTGCCTCCTCACAGTTCGAGCACTTGGAGGGCTGCTGAAGTTCCTGGGTCGAAGAAGAATCGGGGTTGAACTGGAA
:::.::.::.::.::.::::::::::::::.:::   ::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::
CCTTTCCTCTATCATCCCCTTTGACTGCCTTCTC---GTTCGAGCACTTGGAGGGCTGCTCAAGTTCCTGGGTCGAAGAAGAATCGGGGTTGAACTGGAA
--L--S--S--I--I--P--F--D--C--L--L-----V--R--A--L--G--G--L--L--K--F--L--G--R--R--R--I--G--V--E--L--E-

----------------------------------------------><----------------------------------><----------------
-D--Y--N--V--S--V--P--I--L--G--F--K--K--F--M--L--T--H--L--V--N--I--D--Q--D--T--Y--S--V--L--Q--I--F--
GACTATAATGTCAGCGTCCCCATCCTGGGCTTTAAGAAATTTATGTTGACTCATCTGGTGAACATAGATCAAGACACTTACAGTGTTCTACAGATTTTTA
::::::::.::::::::.::::::::::::::::::::::::.::                                                       
GACTATAACGTCAGCGTTCCCATCCTGGGCTTTAAGAAATTTGTG-------------------------------------------------------
-D--Y--N--V--S--V--P--I--L--G--F--K--K--F--V--------------------------------------------------------

-----------------------------------------------------------------><---------------------------------
K--S--E--S--H--P--S--V--Y--K--V--A--S--G--L--K--E--G--L--S--L--F--G--I--L--N--R--C--H--C--K--W--G--E
AGAGTGAGTCTCACCCCTCAGTGTACAAAGTGGCCAGTGGACTGAAGGAGGGGCTCAGCCTCTTTGGAATCCTCAACAGATGCCACTGTAAGTGGGGAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
--K--L--L--R--L--W--F--T--R--P--T--H--D--L--G--E--L--S--S--R--L--D--V--I--Q--F--F--L--L--P--Q--N--L-
GAAGCTGCTCAGGCTATGGTTCACACGTCCGACTCATGACCTGGGGGAGCTCAGTTCTCGTCTGGACGTCATTCAGTTTTTTCTGCTGCCCCAGAATCTG
             :::::::::::::::::.::::: :::::::::::::: :.::::::::::::.::::::::::::::.:::.:.::::::::.:::
-------------CTATGGTTCACACGTCCAACTCAGGACCTGGGGGAGCTAAATTCTCGTCTGGATGTCATTCAGTTTTTCCTGTTACCCCAGAACCTG
--------------L--W--F--T--R--P--T--Q--D--L--G--E--L--N--S--R--L--D--V--I--Q--F--F--L--L--P--Q--N--L-

--------------------------------------------------><------------------------------------------------
-D--M--A--Q--M--L--H--R--L--L--G--H--I--K--N--V--P--L--I--L--K--R--M--K--L--S--H--T--K--V--S--D--W--
GACATGGCTCAGATGCTGCATCGGCTCCTGGGTCACATCAAGAACGTGCCTCTGATTCTGAAACGCATGAAGTTGTCCCACACCAAGGTCAGCGACTGGC
:::::::: ::::::::::::::..: :::::::::::::::::.:::::::::::::: ::::::::::::::::::::::::::.:::::.:::::::
GACATGGCACAGATGCTGCATCGATTGCTGGGTCACATCAAGAATGTGCCTCTGATTCTTAAACGCATGAAGTTGTCCCACACCAAAGTCAGTGACTGGC
-D--M--A--Q--M--L--H--R--L--L--G--H--I--K--N--V--P--L--I--L--K--R--M--K--L--S--H--T--K--V--S--D--W--

-------------><-------------------------------------------------------------------------------------
Q--V--L--Y--K--T--V--Y--S--A--L--G--L--R--D--A--C--R--S--L--P--Q--S--I--Q--L--F--R--D--I--A--Q--E--F
AGGTTCTCTACAAGACTGTGTACAGTGCCCTGGGCCTGAGGGATGCCTGCCGCTCCCTGCCGCAGTCCATCCAGCTCTTTCGGGACATTGCCCAAGAGTT
::::.::::::::::::::::::::::::::::::::::::::.::::::::.:::::::: ::::::::.::::::::::.::: :::::::: :: ::
AGGTCCTCTACAAGACTGTGTACAGTGCCCTGGGCCTGAGGGACGCCTGCCGTTCCCTGCCCCAGTCCATTCAGCTCTTTCAGGAAATTGCCCACGACTT
Q--V--L--Y--K--T--V--Y--S--A--L--G--L--R--D--A--C--R--S--L--P--Q--S--I--Q--L--F--Q--E--I--A--H--D--F

------------------------------------------><--------------------------------------------------------
--S--D--D--L--H--H--I--A--S--L--I--G--K--V--V--D--F--E--G--S--L--A--E--N--R--F--T--V--L--P--N--I--D-
CTCTGATGACCTGCACCATATCGCCAGCCTCATTGGGAAAGTAGTGGACTTTGAGGGCAGCCTTGCTGAAAATCGCTTCACAGTCCTCCCCAACATAGAT
::::::::::::.:::::.::.::::::::::::::::::   :::::::::::::::::.::::::::::::::::::::::::::.::::::::::::
CTCTGATGACCTACACCACATTGCCAGCCTCATTGGGAAA---GTGGACTTTGAGGGCAGTCTTGCTGAAAATCGCTTCACAGTCCTTCCCAACATAGAT
--S--D--D--L--H--H--I--A--S--L--I--G--K-----V--D--F--E--G--S--L--A--E--N--R--F--T--V--L--P--N--I--D-

---------------><-----------------------------------------------------------------------------------
-P--E--I--D--E--K--K--R--R--L--M--G--L--P--S--F--L--T--E--V--A--R--K--E--L--E--N--L--D--S--R--I--P--
CCTGAAATTGATGAGAAAAAGCGAAGACTGATGGGACTTCCCAGTTTCCTTACTGAGGTTGCCCGCAAGGAGCTGGAGAATCTGGACTCCCGTATTCCTT
:::::::::::::::                                                                                     
CCTGAAATTGATGAG-------------------------------------------------------------------------------------
-P--E--I--D--E--------------------------------------------------------------------------------------

-------------------------><-------------------------------------------------------------------------
S--C--S--V--I--Y--I--P--L--I--G--F--L--L--S--I--P--R--L--P--S--M--V--E--A--S--D--F--E--I--N--G--L--D
CATGCAGTGTCATCTACATCCCTCTGATTGGCTTCCTTCTTTCTATTCCCCGCCTGCCTTCCATGGTAGAGGCCAGTGACTTTGAGATTAATGGACTGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><--------------------------------------------------------------------------------------><----
--F--M--F--L--S--E--E--K--L--H--Y--R--S--A--R--T--K--E--L--D--A--L--L--G--D--L--H--C--E--I--R--D--Q-
CTTCATGTTTCTCTCAGAGGAGAAGCTGCACTATCGTAGTGCCCGAACCAAGGAGCTGGATGCATTGCTGGGGGACCTGCACTGCGAGATCCGGGACCAG
       ::.::::::::::::::::::::::::::::::::.::::::::::::::::::                                       
-------TTCCTCTCAGAGGAGAAGCTGCACTATCGTAGTGCTCGAACCAAGGAGCTGGAT---------------------------------------
--------F--L--S--E--E--K--L--H--Y--R--S--A--R--T--K--E--L--D----------------------------------------

----------------------------------------------------------------------------------------------------
-E--T--L--L--M--Y--Q--L--Q--C--Q--V--L--A--R--A--A--V--L--T--R--V--L--D--L--A--S--R--L--D--V--L--L--
GAGACGCTGCTGATGTACCAGCTACAGTGCCAGGTGCTGGCACGAGCAGCTGTCTTAACCCGAGTATTGGACCTTGCCTCCCGCCTGGACGTCCTGCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------><--------------
A--L--A--S--A--A--R--D--Y--G--Y--S--R--P--R--Y--S--P--Q--V--L--G--V--R--I--Q--N--G--R--H--P--L--M--E
CTCTTGCCAGTGCTGCCCGGGACTATGGCTACTCAAGGCCGCGTTACTCCCCACAAGTCCTTGGGGTACGAATCCAGAATGGCAGACATCCTCTGATGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--C--A--R--T--F--V--P--N--S--T--E--C--G--G--D--K--G--R--V--K--V--I--T--G--P--N--S--S--G--K--S--I-
ACTCTGTGCCCGAACCTTTGTGCCCAACTCCACAGAATGTGGTGGGGACAAAGGGAGGGTCAAAGTCATCACTGGACCCAACTCATCAGGGAAGAGCATA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
-Y--L--K--Q--V--G--L--I--T--F--M--A--L--V--G--S--F--V--P--A--E--E--A--E--I--G--A--V--D--A--I--F--T--
TACCTCAAACAGGTAGGCTTGATCACATTCATGGCCCTGGTAGGCAGCTTTGTGCCAGCAGAGGAGGCCGAAATTGGGGCAGTAGACGCCATCTTCACAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------><-------------------------------------
R--I--H--S--C--E--S--I--S--L--G--L--S--T--F--M--I--D--L--N--Q--V--A--K--A--V--N--N--A--T--A--Q--S--L
GAATTCATAGCTGCGAATCCATCTCCCTTGGCCTCTCCACCTTCATGATCGACCTCAACCAGGTGGCGAAAGCAGTGAACAATGCCACTGCACAGTCGCT
                                                                 ::::::::.::::::::.::::::: .:.::: ::
-----------------------------------------------------------------GCGAAAGCGGTGAACAACGCCACTGAGCGGTCTCT
------------------------------------------------------------------A--K--A--V--N--N--A--T--E--R--S--L

------------------------------------><--------------------------------------------------------------
--V--L--I--D--E--F--G--K--G--T--N--T--V--D--G--L--A--L--L--A--A--V--L--R--H--W--L--A--R--G--P--T--C-
GGTCCTTATTGATGAATTTGGAAAGGGAACCAACACGGTGGATGGGCTCGCGCTTCTGGCCGCTGTGCTCCGACACTGGCTGGCACGTGGACCCACATGC
::::::::::::::::::::::::.::::::::::::         .:.::.::.::: :.:::::: ::::::::::::::::.: ::::::::..::.
GGTCCTTATTGATGAATTTGGAAAAGGAACCAACACG---------TTTGCACTCCTGCCTGCTGTGATCCGACACTGGCTGGCGCTTGGACCCATGTGT
--V--L--I--D--E--F--G--K--G--T--N--T-----------F--A--L--L--P--A--V--I--R--H--W--L--A--L--G--P--M--C-

-----------------------------------------------------------------------------------><---------------
-P--H--I--F--V--A--T--N--F--L--S--L--V--Q--L--Q--L--L--P--Q--G--P--L--V--Q--Y--L--T--M--E--T--C--E--
CCCCACATCTTTGTGGCCACCAACTTTCTGAGCCTTGTTCAGCTACAACTGCTGCCACAAGGGCCCCTGGTGCAGTATTTGACCATGGAGACCTGTGAGG
:::::.:::::::::::::::::::::::::::::::::::::::::.::::::::.:: :::::.:: ::::::::::::                   
CCCCATATCTTTGTGGCCACCAACTTTCTGAGCCTTGTTCAGCTACAGCTGCTGCCGCA-GGGCCTCTTGTGCAGTATTTG-------------------
-P--H--I--F--V--A--T--N--F--L--S--L--V--Q--L--Q--L--L--P--Q--G--P--L--V--Q--Y--L--------------------

----------------------------------------------------------------------------------------------------
D--G--N--D--L--V--F--F--Y--Q--V--C--E--G--V--A--K--A--S--H--A--S--H--T--A--A--Q--A--G--L--P--D--K--L
ATGGCAACGATCTTGTCTTCTTCTATCAGGTTTGCGAAGGTGTTGCGAAGGCCAGCCATGCCTCCCACACAGCTGCCCAGGCTGGGCTTCCTGACAAGCT
                                   ::::::::: : :: ::::::::::::::::::::::::::::::: ::::::::::::::.. :
-----------------------------------GAAGGTGTTTCCAATGCCAGCCATGCCTCCCACACAGCTGCCCAGGATGGGCTTCCTGACAGAGT
------------------------------------E--G--V--S--N--A--S--H--A--S--H--T--A--A--Q--D--G--L--P--D--R--V

---------------------><------------------------------------------------------------------------><---
--V--A--R--G--K--E--V--S--D--L--I--R--S--G--K--P--I--K--P--V--K--D--L--L--K--K--N--Q--M--E--N--C--Q-
TGTGGCTCGTGGCAAGGAGGTCTCAGACTTGATCCGCAGTGGAAAACCCATCAAGCCTGTCAAGGATTTGCTAAAGAAGAACCAAATGGAAAATTGCCAG
..: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: .::::::::. ::: :::::::::   ::.:::
CATTGCTCGTGGCAAGGAGGTCTCAGACTTGATCCGCAGTGGAAAACCCATCAAGCCTGTCAAGGAGCTGCTAAAGGCGAAGCAAATGGAA---TGTCAG
--I--A--R--G--K--E--V--S--D--L--I--R--S--G--K--P--I--K--P--V--K--E--L--L--K--A--K--Q--M--E-----C--Q-

----------------------------------------------------------------------------------------------------
-T--L--V--D--K--F--M--K--L--D--L--E--D--P--N--L--D--L--N--V--F--M--S--Q--E--V--L--P--A--A--T--S--I--
ACATTAGTGGATAAGTTTATGAAACTGGATTTGGAAGATCCTAACCTGGACTTGAACGTTTTCATGAGCCAGGAAGTGCTGCCTGCTGCCACCAGCATCC
::::::::.::::::::: :::::.:.::::::::::::::.:..::::::.::.: .. ::::::::.::::::::::::::.::.::::: . :::::
ACATTAGTAGATAAGTTTCTGAAATTAGATTTGGAAGATCCCAGTCTGGACCTGGAGACGTTCATGAGTCAGGAAGTGCTGCCCGCCGCCACGGCCATCC
-T--L--V--D--K--F--L--K--L--D--L--E--D--P--S--L--D--L--E--T--F--M--S--Q--E--V--L--P--A--A--T--A--I--

-----
L--*-
TCTGA
:.:::
TTTGA
L--*-

Pig Consensus Sequence

>BGISUST0000902218
----------------------------------------------------------------------------------------------------
-----------------------------------------------ATTCATCTGTGTGTGCTGTGGAATTCAGGACACCTGGGCATTGCCTACTATGA
CACTGGTGACTCCACCATCCACTTCATGCCAGATGCCCCAGACCATGAGAGCCTCAAGCTGCTGCAGAGA---CTGGATGAAATCAATCCCCTGTCTGTT
GTTACCAGCGCCAAACAGGATGAGAATATGACCCGATTTCTGGGAAAGCTT---TCCCAGGATCACAGAGCGCCTAAGAGACCTGAAATTGTATTTTTGC
CAAGTGTGGATTTT---CTGGAGATAAGCAAACAGCGCCTGCTTTCTGGAAATTACTCCTTCATCCCTGACTCCATGACTGCCACTGAGAAAATCCTCTT
CCTTTCCTCTATCATCCCCTTTGACTGCCTTCTC---GTTCGAGCACTTGGAGGGCTGCTCAAGTTCCTGGGTCGAAGAAGAATCGGGGTTGAACTGGAA
GACTATAACGTCAGCGTTCCCATCCTGGGCTTTAAGAAATTTGTG-------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------CTATGGTTCACACGTCCAACTCAGGACCTGGGGGAGCTAAATTCTCGTCTGGATGTCATTCAGTTTTTCCTGTTACCCCAGAACCTG
GACATGGCACAGATGCTGCATCGATTGCTGGGTCACATCAAGAATGTGCCTCTGATTCTTAAACGCATGAAGTTGTCCCACACCAAAGTCAGTGACTGGC
AGGTCCTCTACAAGACTGTGTACAGTGCCCTGGGCCTGAGGGACGCCTGCCGTTCCCTGCCCCAGTCCATTCAGCTCTTTCAGGAAATTGCCCACGACTT
CTCTGATGACCTACACCACATTGCCAGCCTCATTGGGAAA---GTGGACTTTGAGGGCAGTCTTGCTGAAAATCGCTTCACAGTCCTTCCCAACATAGAT
CCTGAAATTGATGAG-------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------TTCCTCTCAGAGGAGAAGCTGCACTATCGTAGTGCTCGAACCAAGGAGCTGGAT---------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------GCGAAAGCGGTGAACAACGCCACTGAGCGGTCTCT
GGTCCTTATTGATGAATTTGGAAAAGGAACCAACACG---------TTTGCACTCCTGCCTGCTGTGATCCGACACTGGCTGGCGCTTGGACCCATGTGT
CCCCATATCTTTGTGGCCACCAACTTTCTGAGCCTTGTTCAGCTACAGCTGCTGCCggGGCCTCTTGTGCAGTATTTG----------------------
--------------------------------GAAGGTGTTTCCAATGCCAGCCATGCCTCCCACACAGCTGCCCAGGATGGGCTTCCTGACAGAGTCAT
TGCTCGTGGCAAGGAGGTCTCAGACTTGATCCGCAGTGGAAAACCCATCAAGCCTGTCAAGGAGCTGCTAAAGGCGAAGCAAATGGAA---TGTCAGACA
TTAGTAGATAAGTTTCTGAAATTAGATTTGGAAGATCCCAGTCTGGACCTGGAGACGTTCATGAGTCAGGAAGTGCTGCCCGCCGCCACGGCCATCCTTT
GA


>BGISUSP0000902218
-------------------------------------------------IHLCVLWNSGHLGIAYYDTGDSTIHFMPDAPDHESLKLLQR-LDEINPLSV
VTSAKQDENMTRFLGKL-SQDHRAPKRPEIVFLPSVDF-LEISKQRLLSGNYSFIPDSMTATEKILFLSSIIPFDCLL-VRALGGLLKFLGRRRIGVELE
DYNVSVPILGFKKFV--------------------------------------------------------LWFTRPTQDLGELNSRLDVIQFFLLPQNL
DMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFQEIAHDFSDDLHHIASLIGK-VDFEGSLAENRFTVLPNID
PEIDE----------------------------------------------------------------FLSEEKLHYRSARTKELD-------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------AKAVNNATERSLVLIDEFGKGTNT---FALLPAVIRHWLALGPMC
PHIFVATNFLSLVQLQLLPGPLVQYL------------------EGVSNASHASHTAAQDGLPDRVIARGKEVSDLIRSGKPIKPVKELLKAKQME-CQT
LVDKFLKLDLEDPSLDLETFMSQEVLPAATAIL*