Sequences
EST Library Info
cbl1Blood
che1Heart - RNA from China
cly1Lymph - RNA from China
cov1Ovary - RNA from China
eje2Foetus 50 days, jejunum
fat3Fatt
hlv2Heart, left ventricle
jca2Joint capsule
nco2Newborn 115 days, colon
nje1Newborn 115 days, jejunum
nlu1Newborn 115 days, lung
pigca3Unavailable
pigcb2Unavailable
ssp1M. Supraspinatus
Clusters
Oligos
SNPs

Gene ID ENSG00000119718 (click for geneview)
Transcript ID ENST00000266126(link to ensembl)
Symbol EIF2B2
Localtion Chromosome:14:74539399:74546045:1 band: 14q24.3
Description Translation initiation factor eIF-2B beta subunit (eIF-2B GDP-GTP exchange factor) (S20I15) (S20III15). [Source:Uniprot/SWISSPROT;Acc:P49770]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--G--S--A--A--K--G--S--E--L--S--E--R--I--E--S--F--V--E--T--L--K--R--G--G--G--P--R--S--S--E--E--
ATGCCGGGATCCGCAGCGAAGGGCTCGGAGTTGTCAGAGAGGATCGAGAGCTTCGTGGAGACCCTGAAGCGGGGTGGTGGGCCGCGCAGCTCCGAGGAAA
:::::.::. :.:: :: :::.::::::::::::: ::::::::::::::.:::::::::.: :::::.:::::..:.:::: ::.::::::.::::: :
ATGCCAGGGGCTGCCGCCAAGAGCTCGGAGTTGTCCGAGAGGATCGAGAGTTTCGTGGAGGCACTGAAACGGGGCAGCGGGCGGCACAGCTCTGAGGACA
-M--P--G--A--A--A--K--S--S--E--L--S--E--R--I--E--S--F--V--E--A--L--K--R--G--S--G--R--H--S--S--E--D--

--------------------------------------------------------------><------------------------------------
M--A--R--E--T--L--G--L--L--R--Q--I--I--T--D--H--R--W--S--N--A--G--E--L--M--E--L--I--R--R--E--G--R--R
TGGCTCGGGAGACCCTAGGGTTGCTGCGCCAGATCATCACGGACCACCGCTGGAGCAACGCGGGGGAGCTGATGGAGCTGATCCGCAGAGAGGGCAGGAG
::::.:::::::::::.::..:::::::::.:::::::::::::.::::::::::::::      :::::::::::.::::::::::::::.::: ::::
TGGCCCGGGAGACCCTGGGACTGCTGCGCCGGATCATCACGGACTACCGCTGGAGCAAC------GAGCTGATGGAACTGATCCGCAGAGAAGGCCGGAG
M--A--R--E--T--L--G--L--L--R--R--I--I--T--D--Y--R--W--S--N--------E--L--M--E--L--I--R--R--E--G--R--R

-----------------------------------------------------------------------------------><---------------
--M--T--A--A--Q--P--S--E--T--T--V--G--N--M--V--R--R--V--L--K--I--I--R--E--E--Y--G--R--L--H--G--R--S-
GATGACGGCCGCTCAGCCCTCCGAGACCACCGTGGGCAACATGGTGCGGAGAGTGCTCAAGATTATCCGGGAGGAGTATGGCAGACTCCATGGACGCAGC
:::::::::::: :::::::: :::::::::::::::::::::::::::::::::::::.:::.::::::::::::::::::   :::::::::::::::
GATGACGGCCGCGCAGCCCTCAGAGACCACCGTGGGCAACATGGTGCGGAGAGTGCTCAGGATCATCCGGGAGGAGTATGGC---CTCCATGGACGCAGC
--M--T--A--A--Q--P--S--E--T--T--V--G--N--M--V--R--R--V--L--R--I--I--R--E--E--Y--G-----L--H--G--R--S-

----------------------------------------------------------------------------------------------------
-D--E--S--D--Q--Q--E--S--L--H--K--L--L--T--S--G--G--L--N--E--D--F--S--F--H--Y--A--Q--L--Q--S--N--I--
GACGAGAGTGATCAGCAGGAGTCCCTGCACAAACTGTTGACATCCGGAGGCCTAAACGAGGATTTCAGCTTCCATTATGCCCAACTCCAGTCCAACATCA
:::::.::.:::::::::::::::::::::::::: :::::.:::::.:::::.:.:::::::::: :::..::::::::. ::::::::::::::::::
GACGAAAGCGATCAGCAGGAGTCCCTGCACAAACTCTTGACGTCCGGGGGCCTGAGCGAGGATTTCCGCTCTCATTATGCTGAACTCCAGTCCAACATCA
-D--E--S--D--Q--Q--E--S--L--H--K--L--L--T--S--G--G--L--S--E--D--F--R--S--H--Y--A--E--L--Q--S--N--I--

--------------------------------><------------------------------------------------------------------
I--E--A--I--N--E--L--L--V--E--L--E--G--T--M--E--N--I--A--A--Q--A--L--E--H--I--H--S--N--E--V--I--M--T
TTGAGGCGATTAATGAGCTGCTAGTGGAGCTGGAAGGGACAATGGAGAACATTGCAGCCCAGGCTCTGGAGCACATTCACTCCAATGAGGTGATCATGAC
:::::::.:::::::::::::: :::::.:::   :::::::. ::::::::::::::::::::.:::::.:::::.:::::::::::::::::::::::
TTGAGGCAATTAATGAGCTGCTTGTGGAACTG---GGGACAACCGAGAACATTGCAGCCCAGGCCCTGGAACACATCCACTCCAATGAGGTGATCATGAC
I--E--A--I--N--E--L--L--V--E--L-----G--T--T--E--N--I--A--A--Q--A--L--E--H--I--H--S--N--E--V--I--M--T

------------------------------------------------------------------------------------------------><--
--I--G--F--S--R--T--V--E--A--F--L--K--E--A--A--R--K--R--K--F--H--V--I--V--A--E--C--A--P--F--C--Q--G-
CATTGGCTTCTCCCGAACAGTAGAGGCCTTCCTCAAAGAGGCTGCCCGAAAGAGGAAATTCCATGTCATTGTAGCAGAGTGTGCTCCTTTCTGCCAGGGT
:::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::.::::::::::::::::::::.::::::
CATTGGCTTCTCCCGAACAGTAGAGGCCTTCCTCAAAGAGGCAGCCCGAAAGAGGAAATTCCATGTCATTGTGGCAGAGTGTGCTCCTTTCTGTCAGGGT
--I--G--F--S--R--T--V--E--A--F--L--K--E--A--A--R--K--R--K--F--H--V--I--V--A--E--C--A--P--F--C--Q--G-

--------------------------------------------------------------------------------------------><------
-H--E--M--A--V--N--L--S--K--A--G--I--E--T--T--V--M--T--D--A--A--I--F--A--V--M--S--R--V--N--K--V--I--
CATGAAATGGCTGTGAATTTGTCCAAAGCAGGTATTGAGACAACTGTCATGACTGATGCTGCCATTTTTGCCGTTATGTCAAGAGTCAACAAGGTGATCA
:::::.::::: :: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::
CATGAGATGGCGGTCAATTTGTCCAAAGCAGGTATTGAGACAACTGTCATGACTGATGCTGCCATTTTTGCTGTTATGTCAAGAGTCAATAAGGTGATCA
-H--E--M--A--V--N--L--S--K--A--G--I--E--T--T--V--M--T--D--A--A--I--F--A--V--M--S--R--V--N--K--V--I--

----------------------------------------------------------------------------------------------------
I--G--T--K--T--I--L--A--N--G--A--L--R--A--V--T--G--T--H--T--L--A--L--A--A--K--H--H--S--T--P--L--I--V
TTGGCACGAAGACCATCCTGGCCAATGGGGCCCTGAGAGCTGTGACAGGAACTCACACTCTGGCACTGGCAGCAAAACACCATTCCACCCCACTCATCGT
:::::::.:::::::::::::::::::: ::.:::::::::::::::::::: ::.:::.:.::::::::::::::::::::::::::::::::::::::
TTGGCACAAAGACCATCCTGGCCAATGGTGCTCTGAGAGCTGTGACAGGAACACATACTTTAGCACTGGCAGCAAAACACCATTCCACCCCACTCATCGT
I--G--T--K--T--I--L--A--N--G--A--L--R--A--V--T--G--T--H--T--L--A--L--A--A--K--H--H--S--T--P--L--I--V

------------------------------><-----------------------------------------------------------------><-
--C--A--P--M--F--K--L--S--P--Q--F--P--N--E--E--D--S--F--H--K--F--V--A--P--E--E--V--L--P--F--T--E--G-
CTGTGCACCTATGTTCAAACTTTCTCCACAGTTCCCCAATGAAGAAGACTCATTTCATAAGTTTGTGGCTCCTGAAGAAGTCCTGCCATTCACAGAAGGG
:::::: :::::::::::::::::.:::::::::::::::::::::::.::::::::.::.::::::::.::::::::::::.:::: :::::::::   
CTGTGCTCCTATGTTCAAACTTTCCCCACAGTTCCCCAATGAAGAAGATTCATTTCACAAATTTGTGGCCCCTGAAGAAGTCTTGCCTTTCACAGAA---
--C--A--P--M--F--K--L--S--P--Q--F--P--N--E--E--D--S--F--H--K--F--V--A--P--E--E--V--L--P--F--T--E----

----------------------------------------------------------------------------------------------------
-D--I--L--E--K--V--S--V--H--C--P--V--F--D--Y--V--P--P--E--L--I--T--L--F--I--S--N--I--G--G--N--A--P--
GACATTCTGGAGAAGGTCAGCGTGCATTGCCCTGTGTTTGACTACGTTCCCCCAGAGCTCATTACCCTCTTTATCTCCAACATTGGTGGGAATGCACCTT
::::::::::::::::::::.:: ::.:::::.::::::::::::::.:::::::::::::::::::::::::::::::::::::: ::::::::.:: :
GACATTCTGGAGAAGGTCAGTGTTCACTGCCCCGTGTTTGACTACGTCCCCCCAGAGCTCATTACCCTCTTTATCTCCAACATTGGGGGGAATGCGCCGT
-D--I--L--E--K--V--S--V--H--C--P--V--F--D--Y--V--P--P--E--L--I--T--L--F--I--S--N--I--G--G--N--A--P--

------------------------------------------------------->
S--Y--I--Y--R--L--M--S--E--L--Y--H--P--D--D--H--V--L--*-
CCTACATCTACCGCCTGATGAGTGAACTCTACCATCCTGATGATCATGTTTTATGA
:::::::::::::::::::::::::::::::::::::.::.:::::.:: .:::::
CCTACATCTACCGCCTGATGAGTGAACTCTACCATCCCGACGATCACGTGCTATGA
S--Y--I--Y--R--L--M--S--E--L--Y--H--P--D--D--H--V--L--*-

Pig Consensus Sequence

>BGISUST0000899139
ATGCCAGGGGCTGCCGCCAAGAGCTCGGAGTTGTCCGAGAGGATCGAGAGTTTCGTGGAGGCACTGAAACGGGGCAGCGGGCGGCACAGCTCTGAGGACA
TGGCCCGGGAGACCCTGGGACTGCTGCGCCGGATCATCACGGACTACCGCTGGAGCAAC------GAGCTGATGGAACTGATCCGCAGAGAAGGCCGGAG
GATGACGGCCGCGCAGCCCTCAGAGACCACCGTGGGCAACATGGTGCGGAGAGTGCTCAGGATCATCCGGGAGGAGTATGGC---CTCCATGGACGCAGC
GACGAAAGCGATCAGCAGGAGTCCCTGCACAAACTCTTGACGTCCGGGGGCCTGAGCGAGGATTTCCGCTCTCATTATGCTGAACTCCAGTCCAACATCA
TTGAGGCAATTAATGAGCTGCTTGTGGAACTG---GGGACAACCGAGAACATTGCAGCCCAGGCCCTGGAACACATCCACTCCAATGAGGTGATCATGAC
CATTGGCTTCTCCCGAACAGTAGAGGCCTTCCTCAAAGAGGCAGCCCGAAAGAGGAAATTCCATGTCATTGTGGCAGAGTGTGCTCCTTTCTGTCAGGGT
CATGAGATGGCGGTCAATTTGTCCAAAGCAGGTATTGAGACAACTGTCATGACTGATGCTGCCATTTTTGCTGTTATGTCAAGAGTCAATAAGGTGATCA
TTGGCACAAAGACCATCCTGGCCAATGGTGCTCTGAGAGCTGTGACAGGAACACATACTTTAGCACTGGCAGCAAAACACCATTCCACCCCACTCATCGT
CTGTGCTCCTATGTTCAAACTTTCCCCACAGTTCCCCAATGAAGAAGATTCATTTCACAAATTTGTGGCCCCTGAAGAAGTCTTGCCTTTCACAGAA---
GACATTCTGGAGAAGGTCAGTGTTCACTGCCCCGTGTTTGACTACGTCCCCCCAGAGCTCATTACCCTCTTTATCTCCAACATTGGGGGGAATGCGCCGT
CCTACATCTACCGCCTGATGAGTGAACTCTACCATCCCGACGATCACGTGCTATGA


>BGISUSP0000899139
MPGAAAKSSELSERIESFVEALKRGSGRHSSEDMARETLGLLRRIITDYRWSN--ELMELIRREGRRMTAAQPSETTVGNMVRRVLRIIREEYG-LHGRS
DESDQQESLHKLLTSGGLSEDFRSHYAELQSNIIEAINELLVEL-GTTENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRKFHVIVAECAPFCQG
HEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTILANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTE-
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL*