Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
ecc1Foetus 50 days, cortex cerebri
fhi1Unavailable
nlu1Newborn 115 days, lung
Clusters
Oligos
SNPs

Gene ID ENSG00000139266 (click for geneview)
Transcript ID ENST00000266643(link to ensembl)
Symbol MARCH9
Localtion Chromosome:12:56435148:56439465:1 band: 12q14.1
Description membrane-associated RING-CH protein IX [Source:RefSeq_peptide;Acc:NP_612405]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-R--S--R--H--L--P--P--P--S--A--R--A--E--P--S--L--I--P--E--P--E--G--D--W--D--R--E--N--G--D--G--G--R--
AGGAGCCGCCATTTGCCACCGCCGAGCGCACGGGCCGAGCCAAGCCTGATCCCGGAGCCGGAGGGGGACTGGGACCGAGAGAACGGCGATGGGGGGCGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--R--R--R--R--T--R--A--R--N--P--G--G--P--A--R--S--R--P--R--P--A--G--C--G--T--L--S--P--P--P--R--P--L
CCCGCCGCAGGAGGACCCGGGCGCGTAACCCCGGGGGCCCGGCCCGCTCCAGACCCAGACCCGCGGGGTGCGGCACCCTGAGCCCCCCTCCCCGCCCCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--W--P--W--P--P--T--P--P--P--P--G--R--Q--P--A--R--P--R--K--H--R--S--P--G--G--G--S--S--E--R--L--S-
GCCCTGGCCATGGCCGCCCACCCCGCCGCCCCCGGGCCGCCAGCCCGCTCGGCCCCGCAAGCACCGGAGCCCCGGCGGTGGCAGCAGTGAACGGCTGTCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Q--A--P--K--T--P--A--R--L--G--S--L--A--R--A--P--F--P--A--L--S--S--P--L--P--P--P--L--A--S--P--P--C--
CAGGCCCCGAAGACCCCGGCCCGGCTCGGCTCTCTAGCGCGCGCCCCCTTCCCGGCCTTGTCCTCTCCCCTCCCCCCGCCGCTAGCGAGCCCCCCTTGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--L--P--P--A--P--G--V--R--T--M--L--K--S--R--L--R--M--F--L--N--E--L--K--L--L--V--L--T--G--G--G--R--P
CGCTGCCCCCCGCCCCCGGTGTCCGGACGATGCTCAAGTCTCGGCTCCGCATGTTTCTGAACGAGCTGAAGCTGCTGGTGCTGACAGGCGGGGGGCGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--A--E--P--Q--P--R--G--G--R--G--G--G--C--G--W--A--P--F--A--G--C--S--T--R--D--G--D--G--D--E--E--E-
CCGGGCCGAGCCGCAACCCCGGGGGGGCCGGGGAGGCGGCTGCGGCTGGGCGCCCTTCGCTGGCTGCTCCACCCGGGACGGCGACGGCGACGAGGAGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Y--Y--G--S--E--P--R--A--R--G--L--A--G--D--K--E--P--R--A--G--P--L--P--P--P--A--P--P--L--P--P--P--G--
TACTACGGGTCGGAGCCGCGGGCCCGGGGCCTGGCCGGCGACAAGGAGCCGCGGGCCGGACCCCTGCCGCCGCCCGCGCCGCCGCTGCCGCCCCCGGGCG
:::::::::::::::::::::::::::::::::::.:: ::::::::::::::::: :::::::.:::::: ::::: :::::::. :::::::::::::
TACTACGGGTCGGAGCCGCGGGCCCGGGGCCTGGCTGGAGACAAGGAGCCGCGGGCAGGACCCCCGCCGCCTCCCGCTCCGCCGCCTCCGCCCCCGGGCG
-Y--Y--G--S--E--P--R--A--R--G--L--A--G--D--K--E--P--R--A--G--P--P--P--P--P--A--P--P--P--P--P--P--G--

-------------------------------------------------------------------------------------><-------------
A--L--D--A--L--S--L--S--S--S--L--D--S--G--L--R--T--P--Q--C--R--I--C--F--Q--G--P--E--Q--G--E--L--L--S
CGCTGGACGCCCTGTCGCTCAGCAGTAGCCTGGACAGCGGACTCCGAACCCCTCAGTGCCGGATCTGCTTCCAGGGCCCGGAGCAGGGGGAGCTCTTAAG
:::::::::::::.:::::::::::.::::::::::::::.:::::::::::.::::::::.::::::::.::::::::::::::::::::::::.:.::
CGCTGGACGCCCTATCGCTCAGCAGCAGCCTGGACAGCGGGCTCCGAACCCCCCAGTGCCGAATCTGCTTTCAGGGCCCGGAGCAGGGGGAGCTCCTGAG
A--L--D--A--L--S--L--S--S--S--L--D--S--G--L--R--T--P--Q--C--R--I--C--F--Q--G--P--E--Q--G--E--L--L--S

----------------------------------------------------------------------------------------------------
--P--C--R--C--D--G--S--V--R--C--T--H--Q--P--C--L--I--R--W--I--S--E--R--G--S--W--S--C--E--L--C--Y--F-
CCCCTGCCGCTGCGACGGCTCAGTGCGCTGCACGCATCAGCCCTGCCTCATCCGCTGGATCAGCGAGAGGGGCTCCTGGAGCTGTGAGCTCTGCTACTTC
::::::::::::::::::::: ::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCCCTGCCGCTGCGACGGCTCTGTGCGCTGCACGCACCAGCCCTGCCTCATCCGCTGGATCAGCGAGAGGGGCTCCTGGAGCTGTGAGCTCTGCTACTTC
--P--C--R--C--D--G--S--V--R--C--T--H--Q--P--C--L--I--R--W--I--S--E--R--G--S--W--S--C--E--L--C--Y--F-

-----------------------------------------><---------------------------------------------------------
-K--Y--Q--V--L--A--I--S--T--K--N--P--L--Q--W--Q--A--I--S--L--T--V--I--E--K--V--Q--I--A--A--I--V--L--
AAGTACCAGGTCCTGGCGATCAGCACCAAGAACCCACTGCAGTGGCAGGCCATCTCCCTGACGGTCATCGAGAAGGTCCAGATTGCTGCCATAGTTCTGG
::::::::::::::::::::::::::::::::.:: ::::::::::::::::::::::::::::::::.::::::::::::::::: :::::::::::::
AAGTACCAGGTCCTGGCGATCAGCACCAAGAATCCCCTGCAGTGGCAGGCCATCTCCCTGACGGTCATTGAGAAGGTCCAGATTGCAGCCATAGTTCTGG
-K--Y--Q--V--L--A--I--S--T--K--N--P--L--Q--W--Q--A--I--S--L--T--V--I--E--K--V--Q--I--A--A--I--V--L--

----------------------------------------------------------------------------------------------------
G--S--L--F--L--V--A--S--I--S--W--L--I--W--S--S--L--S--P--S--A--K--W--Q--R--Q--D--L--L--F--Q--I--C--Y
GCTCGCTCTTCCTGGTTGCCAGCATCTCCTGGCTCATCTGGTCCTCACTCAGCCCTTCAGCCAAGTGGCAACGACAGGATCTGCTCTTTCAGATCTGCTA
:::: :::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::
GCTCTCTCTTCCTCGTTGCCAGCATCTCCTGGCTCATCTGGTCCTCACTCAGCCCTTCAGCCAAGTGGCAACGGCAAGATCTGCTCTTTCAGATCTGCTA
G--S--L--F--L--V--A--S--I--S--W--L--I--W--S--S--L--S--P--S--A--K--W--Q--R--Q--D--L--L--F--Q--I--C--Y

----------------------------------><----------------------------------------------------------------
--G--M--Y--G--F--M--D--V--V--C--I--G--L--I--I--H--E--G--S--S--V--Y--R--I--F--K--R--W--Q--A--V--N--Q-
CGGCATGTATGGCTTCATGGATGTCGTCTGCATAGGCCTCATCATCCATGAAGGCTCCTCTGTCTACCGCATCTTCAAGCGCTGGCAGGCAGTGAACCAG
::::::::::::::::::::::::::::::::::   ::::::.:::::::::::::::::::::::::.::::::::::::::::::::::::::::::
CGGCATGTATGGCTTCATGGATGTCGTCTGCATA---CTCATCGTCCATGAAGGCTCCTCTGTCTACCGTATCTTCAAGCGCTGGCAGGCAGTGAACCAG
--G--M--Y--G--F--M--D--V--V--C--I-----L--I--V--H--E--G--S--S--V--Y--R--I--F--K--R--W--Q--A--V--N--Q-

----------------------------------------------------------------------------------------------------
-Q--W--K--V--L--N--Y--D--K--T--K--D--I--G--G--D--A--G--G--G--T--A--G--K--S--G--P--R--N--S--R--T--G--
CAGTGGAAGGTCCTAAATTATGACAAGACCAAGGACATAGGAGGAGATGCAGGGGGAGGGACGGCAGGGAAGTCAGGCCCCAGGAACTCACGGACGGGCC
::::::::::::::.:::::.::.::::::::::::::::::::::::::::::::::::::::::::::::.:.:::::::::: ::::::::::::::
CAGTGGAAGGTCCTGAATTACGATAAGACCAAGGACATAGGAGGAGATGCAGGGGGAGGGACGGCAGGGAAGCCGGGCCCCAGGACCTCACGGACGGGCC
-Q--W--K--V--L--N--Y--D--K--T--K--D--I--G--G--D--A--G--G--G--T--A--G--K--P--G--P--R--T--S--R--T--G--

----------------------------------------------------------------------------------------------------
P--T--S--G--A--T--S--R--P--P--A--A--Q--R--M--R--T--L--L--P--Q--R--C--G--Y--T--I--L--H--L--L--G--Q--L
CCACCTCTGGGGCCACGAGCCGCCCCCCAGCTGCCCAGCGCATGCGGACGCTCTTGCCTCAGCGCTGCGGTTATACAATCTTGCACCTCCTTGGGCAGCT
:: ::::::::::::: ::::::::.::::::.::::::::::::::::::::::::::::::::::.:::::.::::::.::::.::::::::.:::::
CCCCCTCTGGGGCCACTAGCCGCCCTCCAGCTACCCAGCGCATGCGGACGCTCTTGCCTCAGCGCTGTGGTTACACAATCCTGCATCTCCTTGGACAGCT
P--P--S--G--A--T--S--R--P--P--A--T--Q--R--M--R--T--L--L--P--Q--R--C--G--Y--T--I--L--H--L--L--G--Q--L

--------------------------------------------------------------------->
--R--P--P--D--A--R--S--S--S--H--S--G--R--E--V--V--M--R--V--T--T--V--*-
GCGGCCACCAGATGCCCGTTCCAGCTCCCATTCTGGCCGAGAGGTTGTCATGAGGGTCACTACAGTCTGA
::::::::::::::::::::::::.::.::::::::::: ::::::::::::::::::::.::.::::::
GCGGCCACCAGATGCCCGTTCCAGTTCTCATTCTGGCCGTGAGGTTGTCATGAGGGTCACCACGGTCTGA
--R--P--P--D--A--R--S--S--S--H--S--G--R--E--V--V--M--R--V--T--T--V--*-

Pig Consensus Sequence

>BGISUST0000879819
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
TACTACGGGTCGGAGCCGCGGGCCCGGGGCCTGGCTGGAGACAAGGAGCCGCGGGCAGGACCCCCGCCGCCTCCCGCTCCGCCGCCTCCGCCCCCGGGCG
CGCTGGACGCCCTATCGCTCAGCAGCAGCCTGGACAGCGGGCTCCGAACCCCCCAGTGCCGAATCTGCTTTCAGGGCCCGGAGCAGGGGGAGCTCCTGAG
CCCCTGCCGCTGCGACGGCTCTGTGCGCTGCACGCACCAGCCCTGCCTCATCCGCTGGATCAGCGAGAGGGGCTCCTGGAGCTGTGAGCTCTGCTACTTC
AAGTACCAGGTCCTGGCGATCAGCACCAAGAATCCCCTGCAGTGGCAGGCCATCTCCCTGACGGTCATTGAGAAGGTCCAGATTGCAGCCATAGTTCTGG
GCTCTCTCTTCCTCGTTGCCAGCATCTCCTGGCTCATCTGGTCCTCACTCAGCCCTTCAGCCAAGTGGCAACGGCAAGATCTGCTCTTTCAGATCTGCTA
CGGCATGTATGGCTTCATGGATGTCGTCTGCATA---CTCATCGTCCATGAAGGCTCCTCTGTCTACCGTATCTTCAAGCGCTGGCAGGCAGTGAACCAG
CAGTGGAAGGTCCTGAATTACGATAAGACCAAGGACATAGGAGGAGATGCAGGGGGAGGGACGGCAGGGAAGCCGGGCCCCAGGACCTCACGGACGGGCC
CCCCCTCTGGGGCCACTAGCCGCCCTCCAGCTACCCAGCGCATGCGGACGCTCTTGCCTCAGCGCTGTGGTTACACAATCCTGCATCTCCTTGGACAGCT
GCGGCCACCAGATGCCCGTTCCAGTTCTCATTCTGGCCGTGAGGTTGTCATGAGGGTCACCACGGTCTGA


>BGISUSP0000879819
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
YYGSEPRARGLAGDKEPRAGPPPPPAPPPPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYF
KYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCI-LIVHEGSSVYRIFKRWQAVNQ
QWKVLNYDKTKDIGGDAGGGTAGKPGPRTSRTGPPSGATSRPPATQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV*