Sequences
reye1627b_e10.y1est
rpigcb_0911.y1est
rtra31_h2.y1est
rpigca0_003865.y1est
BQ603318est
ruio10_j24.y1est
rvin030_a20.y1est
rpgl11_g19.y1est
rpigca0_009256.y1est
rpigca0_008494.y1est
rpigca0_012586.y1est
rpigca0_014209.y1est
rthg14_o6.y1est
ruio22_j12.y1est
rpldo0138_p20.y1est
rret30_p5.y1est
rvin021_f6.y1est
ruio35_f23.y1est
rpigca0_015736.y1est
rpigca0_007596.y1est
rmgp032_l20.y1est
DV901098est
rcki33_p23.y1est
CK466458est
rbdd_14675.y1reads
rpigca0_011340.y1est
rpigca0_007628.y1est
rpigca0_007645.y1est
rpliv0124_h14.y1est
rpigca0_004678.y1est
rpigca0_014663.y1est
rpigca0_008380.y1est
rlyg32_i11.y1est
ruio02_o6.y1est
rlin02_i5r1.y1est
rpigca0_009337.y1est
ruio21_b15.y1est
rmgp032_d12.y1est
rpigca0_011750.y1est
rssp07_i19.y1est
CF178229est
rpigca0_006280.y1est
ruio32_e17.y1est
rplun0106_g5.y1est
rnca33b_m12.y1est
rplun0132_b14.y1est
ruio11_n18.y1est
CB287904est
ruio27_a23.y1est
rpigca0_014753.y1est
rpigca0_015760.y1est
rdbla0123_n10.y1est
ruio01_p1.y1est
rdpcxb0_114955.y1reads
rret32_k21.y1est
AW620089est
DN102690est
rssp31_c18.y1est
ruio10_g24.y1est
ruio06_l13.y1est
rpigca0_004673.y1est
risp26_m24.y1est
rste21_m15.y1est
ruio35_i15.y1est
rdpcxa0_011283.y1reads
rgul0113_g24.y1est
rplun0134_e14.y1est
DN124430est
rnje21c_j23.y1est
rpigca0_016170.y1est
rpgl01_o6.y1est
DN124139est
rpigca0_004286.y1est
rhea25_l20.y1est
ruio12_p10.y1est
rpigca0_005632.y1est
AW786619est
ruio31_l9.y1est
rpldo0108_h16.y1est
rplun0139_o18.y1est
rtra04_g5r1.y1est
rpigca0_015164.y1est
rplun0106_f3.y1est
rpro32_d2.y1est
rpigca0_003603.y1est
rpgl07_j12.y1est
AJ655872est
rpgl15_a22.y1est
DY431294est
rnje20c_g1.y1est
rcki03_e20.y1est
rpigca0_005776.y1est
rplun0113_e20.y1est
rpigca0_010796.y1est
rvin039_b10.y1est
risp04_n17.y1est
rpigca0_005514.y1est
rpigca0_007921.y1est
rspc025_j19.y1est
rcbe27_m17.y1est
ruio11_i9.y1est
BI400025est
rpigca0_012782.y1est
relu1319b_c23.y1est
rpigca0_014946.y1est
rpigca0_009522.y1est
rpgl17_i4.y1est
ruio01_f5.y1est
rssp30_n22.y1est
risp15_k3.y1est
rplun0106_b10.y1est
byf_46624.z1reads
rpigca0_014674.y1est
BI337717est
rpigca0_005430.y1est
rpigca0_015782.y1est
rpigca0_014227.y1est
rthg20_i11.y1est
rpigca0_005510.y1est
CK464372est
rpigca0_016819.y1est
CV870316est
rpigca0_005536.y1est
ruio12_j7.y1est
rpigca0_009737.y1est
rvin020_p6.y1est
rplun0112_l23.y1est
rpigca0_016296.y1est
AJ653963est
rpigca0_015793.y1est
rmgp033_e12.y1est
rsto212_h11.y1est
rvin18_p21.y1est
ruio06_f8.y1est
rpigca0_016921.y1est
ruio33_l21.y1est
risp17_i23.y1est
EST Library Info
cbe1Cerebellum
cki3Kidney - RNA from China
dbla1Unavailable
elu1Foetus 50 days, lung
eye1Foetus 50 days, Eye
gul3Gullet
hea1Heart
isp6M. Infraspinatus
lin2Large intestine
lyg1Lymphatic gland
mgp3Mammary gland - 7 days pre birth
nca2Newborn 115 days, cartillage
nje3Newborn 115 days, jejunum
pgl5Pituitary gland
pigca56Unavailable
pigcb1Unavailable
pldo2Unavailable
plun13Unavailable
pro2Prostata
ret4Retina
spc1Spinal cord
ssp4M. Supraspinatus
ste1M. Semitendinosus
sto1Stomach
thg2Thyroid gland
tra2Trachea
uio30Unavailable
vin6M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000140043 (click for geneview)
Transcript ID ENST00000267568(link to ensembl)
Symbol ZADH1
Localtion Chromosome:14:73388424:73421915:1 band: 14q24.3
Description Zinc-binding alcohol dehydrogenase domain containing protein 1 (EC 1.-.-.-). [Source:Uniprot/SWISSPROT;Acc:Q8N8N7]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------><--------------------------------------------------------------
-M--I--V--Q--R--V--V--L--N--S--R--P--G--K--N--G--N--P--V--A--E--N--F--R--M--E--E--V--Y--L--P--D--N--
ATGATTGTTCAAAGAGTGGTATTGAATTCTCGACCTGGAAAAAATGGTAATCCAGTGGCAGAGAATTTCCGAATGGAAGAAGTCTATTTACCAGATAATA
                                       :::::::::::::::::::::::::::::::::.:.::::::::  :.:::::::: ::::
---------------------------------------AAAAATGGTAATCCAGTGGCAGAGAATTTCCGAGTAGAAGAAGTAAACTTACCAGAGAATA
----------------------------------------K--N--G--N--P--V--A--E--N--F--R--V--E--E--V--N--L--P--E--N--

-------------------------------------------------------><-------------------------------------------
I--N--E--G--Q--V--Q--V--R--T--L--Y--L--S--V--D--P--Y--M--R--C--R--M--N--E--D--T--G--T--D--Y--I--T--P
TTAATGAAGGACAAGTACAAGTTAGAACTCTTTATCTTTCTGTGGATCCTTACATGCGTTGTAGAATGAATGAAGACACTGGCACTGATTATATAACACC
:.::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::
TCAATGAAGGACAAGTGCAAGTCAGAACTCTTTATCTTTCTGTGGATCCTTACATGCGTTGTAGAATGAATGAAGACACTGGCTCTGATTATATAACACC
I--N--E--G--Q--V--Q--V--R--T--L--Y--L--S--V--D--P--Y--M--R--C--R--M--N--E--D--T--G--S--D--Y--I--T--P

----------------------------------------------------------------------------------------------------
--W--Q--L--S--Q--V--V--D--G--G--G--I--G--I--I--E--E--S--K--H--T--N--L--T--K--G--D--F--V--T--S--F--Y-
TTGGCAGCTATCTCAAGTCGTTGATGGAGGAGGTATTGGAATTATAGAAGAAAGCAAACACACAAATTTGACTAAAGGCGATTTTGTGACTTCTTTCTAT
:::::::::.:::::.:: :::::::: ::::::.::::.::.:::::::::::::.:::::::::::: ::::::::.:::::::::: ::::::::::
TTGGCAGCTGTCTCAGGTGGTTGATGGTGGAGGTGTTGGGATCATAGAAGAAAGCAGACACACAAATTTTACTAAAGGTGATTTTGTGAGTTCTTTCTAT
--W--Q--L--S--Q--V--V--D--G--G--G--V--G--I--I--E--E--S--R--H--T--N--F--T--K--G--D--F--V--S--S--F--Y-

-----------------------------------------------><---------------------------------------------------
-W--P--W--Q--T--K--V--I--L--D--G--N--S--L--E--K--V--D--P--Q--L--V--D--G--H--L--S--Y--F--L--G--A--I--
TGGCCCTGGCAAACCAAGGTTATTCTGGATGGAAATAGCCTTGAAAAGGTAGACCCACAACTTGTGGATGGACACCTTTCATATTTTCTTGGAGCTATAG
::::::::::::::::::::::::::::::::::.:: :::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::
TGGCCCTGGCAAACCAAGGTTATTCTGGATGGAAGTATCCTTGAAAAGGTAGACCCACAACTTGTGGATGGACACCTTTCATACTTTCTTGGAGCTATAG
-W--P--W--Q--T--K--V--I--L--D--G--S--I--L--E--K--V--D--P--Q--L--V--D--G--H--L--S--Y--F--L--G--A--I--

----------------------------------------------------------------------------------------------------
G--M--P--G--L--T--S--L--I--G--I--Q--E--K--G--H--I--T--A--G--S--N--K--T--M--V--V--S--G--A--A--G--A--C
GTATGCCTGGTTTGACTTCCTTGATTGGGATACAGGAAAAAGGTCATATAACTGCTGGATCTAATAAGACAATGGTTGTCAGTGGGGCCGCAGGTGCCTG
: :::::::::::::::::::::::::: ::::::::::::::::::.::::::::::::::::: :::::::::::::.::::::::.:: :::::.::
GGATGCCTGGTTTGACTTCCTTGATTGGCATACAGGAAAAAGGTCATGTAACTGCTGGATCTAATCAGACAATGGTTGTTAGTGGGGCTGCTGGTGCTTG
G--M--P--G--L--T--S--L--I--G--I--Q--E--K--G--H--V--T--A--G--S--N--Q--T--M--V--V--S--G--A--A--G--A--C

------------------><--------------------------------------------------------------------------------
--G--S--V--A--G--Q--I--G--H--F--L--G--C--S--R--V--V--G--I--C--G--T--H--E--K--C--I--L--L--T--S--E--L-
TGGATCTGTGGCTGGGCAGATTGGCCATTTCTTAGGTTGTTCCAGAGTGGTGGGAATTTGTGGAACACATGAGAAATGCATCCTCTTGACCTCAGAACTG
::::::. ::::::::::::::::::::::  :.::.::::::::::::::::::::::::::::::::::::::.::: ::::.:::::::::::::::
TGGATCCTTGGCTGGGCAGATTGGCCATTTGATGGGCTGTTCCAGAGTGGTGGGAATTTGTGGAACACATGAGAAGTGCCTCCTTTTGACCTCAGAACTG
--G--S--L--A--G--Q--I--G--H--L--M--G--C--S--R--V--V--G--I--C--G--T--H--E--K--C--L--L--L--T--S--E--L-

----------------------------------------------------------------------------------------------------
-G--F--D--A--A--I--N--Y--K--K--D--N--V--A--E--Q--L--R--E--S--C--P--A--G--V--D--V--Y--F--D--N--V--G--
GGCTTTGATGCTGCAATTAATTATAAAAAAGACAATGTGGCAGAACAGCTCCGTGAATCATGCCCAGCTGGAGTGGATGTTTATTTTGACAATGTTGGTG
:::::::::::::::::::::::::::.:.:. :::::::::::: :.::::.:::.:.::::::.:::::::::::::::::.::::::::::::::::
GGCTTTGATGCTGCAATTAATTATAAAGAGGGGAATGTGGCAGAAAAACTCCATGAGTTATGCCCGGCTGGAGTGGATGTTTACTTTGACAATGTTGGTG
-G--F--D--A--A--I--N--Y--K--E--G--N--V--A--E--K--L--H--E--L--C--P--A--G--V--D--V--Y--F--D--N--V--G--

----------------------------><----------------------------------------------------------------------
G--N--I--S--D--T--V--I--S--Q--M--N--E--N--S--H--I--I--L--C--G--Q--I--S--Q--Y--N--K--D--V--P--Y--P--P
GTAACATCAGTGATACAGTGATAAGTCAGATGAATGAGAACAGCCACATCATCCTGTGTGGTCAAATTTCTCAGTACAACAAAGATGTGCCTTATCCTCC
::.:::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::.::::::::.::::::::::::::::::::::::::
GTGACATCAGTGATACAGTGATAAGTCAGATGAATCAGAACAGCCACATCATCCTGTGTGGTCAGATTTCTCAATACAACAAAGATGTGCCTTATCCTCC
G--D--I--S--D--T--V--I--S--Q--M--N--Q--N--S--H--I--I--L--C--G--Q--I--S--Q--Y--N--K--D--V--P--Y--P--P

--------------------------------------------------><------------------------------------------------
--P--L--S--P--A--I--E--A--I--Q--K--E--R--N--I--T--R--E--R--F--L--V--L--N--Y--K--D--K--F--E--P--G--I-
CCCGCTATCCCCTGCTATAGAGGCAATCCAGAAAGAAAGAAACATCACAAGGGAAAGATTTCTGGTATTAAATTATAAAGACAAATTTGAGCCTGGCATT
.::.:::.:::::::::::::.:::::::::::::::::::::::::::   ::::::::::::::::::::::::::.::::::::::::.::::.:::
TCCACTACCCCCTGCTATAGAAGCAATCCAGAAAGAAAGAAACATCACA---GAAAGATTTCTGGTATTAAATTATAAGGACAAATTTGAGTCTGGTATT
--P--L--P--P--A--I--E--A--I--Q--K--E--R--N--I--T-----E--R--F--L--V--L--N--Y--K--D--K--F--E--S--G--I-

--------------------------------------><--------------------------------------><--------------------
-L--Q--L--S--Q--W--F--K--E--G--K--L--K--I--K--E--T--V--I--N--G--L--E--N--M--G--A--A--F--Q--S--M--M--
CTACAGCTGAGTCAGTGGTTTAAAGAAGGAAAGCTAAAGATTAAAGAGACGGTAATAAATGGGTTGGAAAACATGGGAGCTGCATTCCAGTCCATGATGA
::.::::::::::::::::::::::::::::::::::::                                          :::::::::::::::::::
CTGCAGCTGAGTCAGTGGTTTAAAGAAGGAAAGCTAAAG------------------------------------------GCATTCCAGTCCATGATGA
-L--Q--L--S--Q--W--F--K--E--G--K--L--K--------------------------------------------A--F--Q--S--M--M--

------------------------------------------------------->
T--G--G--N--I--G--K--Q--I--V--C--I--S--E--E--I--S--L--*-
CAGGAGGTAACATTGGAAAGCAGATAGTTTGCATTTCAGAAGAAATCTCTTTGTAA
:::: ::::::::.::::::::::::::::::::.:::.::::::.::::::::::
CAGGTGGTAACATCGGAAAGCAGATAGTTTGCATCTCAAAAGAAACCTCTTTGTAA
T--G--G--N--I--G--K--Q--I--V--C--I--S--K--E--T--S--L--*-

Pig Consensus Sequence

>BGISUST0000882698
---------------------------------------AAAAATGGTAATCCAGTGGCAGAGAATTTCCGAGTAGAAGAAGTAAACTTACCAGAGAATA
TCAATGAAGGACAAGTGCAAGTCAGAACTCTTTATCTTTCTGTGGATCCTTACATGCGTTGTAGAATGAATGAAGACACTGGCTCTGATTATATAACACC
TTGGCAGCTGTCTCAGGTGGTTGATGGTGGAGGTGTTGGGATCATAGAAGAAAGCAGACACACAAATTTTACTAAAGGTGATTTTGTGAGTTCTTTCTAT
TGGCCCTGGCAAACCAAGGTTATTCTGGATGGAAGTATCCTTGAAAAGGTAGACCCACAACTTGTGGATGGACACCTTTCATACTTTCTTGGAGCTATAG
GGATGCCTGGTTTGACTTCCTTGATTGGCATACAGGAAAAAGGTCATGTAACTGCTGGATCTAATCAGACAATGGTTGTTAGTGGGGCTGCTGGTGCTTG
TGGATCCTTGGCTGGGCAGATTGGCCATTTGATGGGCTGTTCCAGAGTGGTGGGAATTTGTGGAACACATGAGAAGTGCCTCCTTTTGACCTCAGAACTG
GGCTTTGATGCTGCAATTAATTATAAAGAGGGGAATGTGGCAGAAAAACTCCATGAGTTATGCCCGGCTGGAGTGGATGTTTACTTTGACAATGTTGGTG
GTGACATCAGTGATACAGTGATAAGTCAGATGAATCAGAACAGCCACATCATCCTGTGTGGTCAGATTTCTCAATACAACAAAGATGTGCCTTATCCTCC
TCCACTACCCCCTGCTATAGAAGCAATCCAGAAAGAAAGAAACATCACA---GAAAGATTTCTGGTATTAAATTATAAGGACAAATTTGAGTCTGGTATT
CTGCAGCTGAGTCAGTGGTTTAAAGAAGGAAAGCTAAAG------------------------------------------GCATTCCAGTCCATGATGA
CAGGTGGTAACATCGGAAAGCAGATAGTTTGCATCTCAAAAGAAACCTCTTTGTAA


>BGISUSP0000882698
-------------KNGNPVAENFRVEEVNLPENINEGQVQVRTLYLSVDPYMRCRMNEDTGSDYITPWQLSQVVDGGGVGIIEESRHTNFTKGDFVSSFY
WPWQTKVILDGSILEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHVTAGSNQTMVVSGAAGACGSLAGQIGHLMGCSRVVGICGTHEKCLLLTSEL
GFDAAINYKEGNVAEKLHELCPAGVDVYFDNVGGDISDTVISQMNQNSHIILCGQISQYNKDVPYPPPLPPAIEAIQKERNIT-ERFLVLNYKDKFESGI
LQLSQWFKEGKLK--------------AFQSMMTGGNIGKQIVCISKETSL*