Sequences
EST Library Info
cbl5Blood
cbr12Brain - RNA from China
csk4Skin - RNA from China
dbla3Unavailable
fat1Fatt
hea1Heart
jca1Joint capsule
nlu1Newborn 115 days, lung
pigcb1Unavailable
ret1Retina
sin1Small intestine
spl1Spleen
ste2M. Semitendinosus
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000140259 (click for geneview)
Transcript ID ENST00000267812(link to ensembl)
Symbol MFAP1
Localtion Chromosome:15:41884025:41904243:-1 band: 15q15.3
Description Microfibrillar-associated protein 1. [Source:Uniprot/SWISSPROT;Acc:P55081]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------------><--------------------
-M--S--V--P--S--A--L--M--K--Q--P--P--I--Q--S--T--A--G--A--V--P--V--R--N--E--K--G--E--I--S--M--E--K--
ATGTCGGTCCCAAGCGCTCTCATGAAGCAACCGCCCATTCAGTCTACGGCTGGGGCCGTCCCAGTTCGCAATGAGAAAGGTGAGATTTCAATGGAAAAAG
            ::::: ::::::::.::::::::.::::::::::::::::::::::::::.:::::::::::::::   ::::::::.::::::::::
------------AGCGCACTCATGAAACAACCGCCTATTCAGTCTACGGCTGGGGCCGTCCCGGTTCGCAATGAGAAA---GAGATTTCGATGGAAAAAG
-------------S--A--L--M--K--Q--P--P--I--Q--S--T--A--G--A--V--P--V--R--N--E--K-----E--I--S--M--E--K--

----------------------------------------------------------------------------------------------------
V--K--V--K--R--Y--V--S--G--K--R--P--D--Y--A--P--M--E--S--S--D--E--E--D--E--E--F--Q--F--I--K--K--A--K
TGAAGGTAAAGCGTTATGTGTCCGGAAAAAGGCCAGACTATGCCCCTATGGAGTCCTCAGATGAGGAGGATGAAGAATTTCAGTTCATTAAGAAAGCCAA
::::::::::.::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGAAGGTAAAACGTTATGTGTCAGGAAAGAGGCCAGACTATGCCCCTATGGAGTCCTCAGATGAGGAGGATGAAGAATTTCAGTTCATTAAGAAAGCCAA
V--K--V--K--R--Y--V--S--G--K--R--P--D--Y--A--P--M--E--S--S--D--E--E--D--E--E--F--Q--F--I--K--K--A--K

--------------------------------------------------------------------------------------------------><
--E--Q--E--A--E--P--E--E--Q--E--E--D--S--S--S--D--P--R--L--R--R--L--Q--N--R--I--S--E--D--V--E--E--R-
AGAACAAGAAGCAGAGCCTGAGGAACAGGAGGAGGATTCATCCAGTGACCCCCGGCTACGGCGTTTACAGAACCGTATTAGTGAAGATGTGGAAGAGAGA
:::::::::::::::::::::::::::.::::::::::::::.::::::::.:::::.::.:::::.::::::::::::::::::::::::::::::   
AGAACAAGAAGCAGAGCCTGAGGAACAAGAGGAGGATTCATCTAGTGACCCTCGGCTGCGACGTTTGCAGAACCGTATTAGTGAAGATGTGGAAGAG---
--E--Q--E--A--E--P--E--E--Q--E--E--D--S--S--S--D--P--R--L--R--R--L--Q--N--R--I--S--E--D--V--E--E----

----------------------------------------------------------------------------------------------------
-L--A--R--H--R--K--I--V--E--P--E--V--V--G--E--S--D--S--E--V--E--G--D--A--W--R--M--E--R--E--D--S--S--
TTGGCTCGACATCGAAAAATAGTGGAACCTGAAGTGGTAGGAGAGAGTGACTCAGAAGTAGAAGGAGATGCTTGGCGCATGGAACGAGAAGACAGCAGTG
::::::::::::::.::::::::::::::.::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::.: :::::
TTGGCTCGACATCGGAAAATAGTGGAACCCGAAGTGGTGGGAGAAAGTGACTCAGAAGTAGAAGGAGATGCTTGGCGCATGGAACGAGAAGATACCAGTG
-L--A--R--H--R--K--I--V--E--P--E--V--V--G--E--S--D--S--E--V--E--G--D--A--W--R--M--E--R--E--D--T--S--

----------------------------><----------------------------------------------------------------------
E--E--E--E--E--E--I--D--D--E--E--I--E--R--R--R--G--M--M--R--Q--R--A--Q--E--R--K--N--E--E--M--E--V--M
AAGAAGAGGAGGAGGAAATTGATGATGAGGAAATAGAGCGGCGGCGTGGCATGATGCGTCAGCGAGCACAGGAGAGAAAAAATGAAGAGATGGAAGTCAT
:::::::.::.::.::.:::::::::::::::::::::::.:: :::::::::::::::::.::::::::::::::::::::::::::::::::::::::
AAGAAGAAGAAGAAGAGATTGATGATGAGGAAATAGAGCGACGCCGTGGCATGATGCGTCAACGAGCACAGGAGAGAAAAAATGAAGAGATGGAAGTCAT
E--E--E--E--E--E--I--D--D--E--E--I--E--R--R--R--G--M--M--R--Q--R--A--Q--E--R--K--N--E--E--M--E--V--M

----------------------------------------------------------------------------------------------------
--E--V--E--D--E--G--R--S--G--E--E--S--E--S--E--S--E--Y--E--E--Y--T--D--S--E--D--E--M--E--P--R--L--K-
GGAAGTGGAAGATGAGGGTCGTTCTGGAGAGGAGTCAGAATCAGAGTCTGAGTATGAAGAGTACACAGACAGTGAAGATGAGATGGAGCCTCGCCTTAAG
:::.:::::::::::::: ::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGAGGTGGAAGATGAGGGGCGTTCTGGGGAGGAGTCAGAATCAGAGTCTGAGTATGAAGAGTACACAGACAGTGAAGATGAGATGGAGCCTCGCCTTAAG
--E--V--E--D--E--G--R--S--G--E--E--S--E--S--E--S--E--Y--E--E--Y--T--D--S--E--D--E--M--E--P--R--L--K-

----------------><----------------------------------------------------------------------------------
-P--V--F--I--R--K--K--D--R--V--T--V--Q--E--R--E--A--E--A--L--K--Q--K--E--L--E--Q--E--A--K--R--M--A--
CCAGTCTTCATTCGAAAGAAGGACCGAGTGACAGTTCAAGAACGTGAAGCCGAAGCATTGAAACAGAAGGAGCTGGAGCAGGAAGCAAAACGCATGGCTG
::::::::::::      :::::::::::.:::::::::::::: ::.:::::::::::::::::::::::::::::::::::.:: :::::::::::::
CCAGTCTTCATT------AAGGACCGAGTAACAGTTCAAGAACGGGAGGCCGAAGCATTGAAACAGAAGGAGCTGGAGCAGGAGGCCAAACGCATGGCTG
-P--V--F--I--------K--D--R--V--T--V--Q--E--R--E--A--E--A--L--K--Q--K--E--L--E--Q--E--A--K--R--M--A--

-------------------------><-------------------------------------------------------------------------
E--E--R--R--K--Y--T--L--K--I--V--E--E--E--T--K--K--E--L--E--E--N--K--R--S--L--A--A--L--D--A--L--N--T
AGGAAAGGCGCAAGTACACACTCAAGATTGTCGAAGAGGAAACCAAAAAAGAGCTGGAAGAGAACAAGCGATCCCTGGCTGCATTGGATGCACTCAATAC
::::.::.:::::.::.:::::::::::::: :::::.::.:::::.:::::::::::.:::::::::::.:::::::::::..:.::::::::::::::
AGGAGAGACGCAAATATACACTCAAGATTGTAGAAGAAGAGACCAAGAAAGAGCTGGAGGAGAACAAGCGGTCCCTGGCTGCGCTAGATGCACTCAATAC
E--E--R--R--K--Y--T--L--K--I--V--E--E--E--T--K--K--E--L--E--E--N--K--R--S--L--A--A--L--D--A--L--N--T

--------------------------------------------------------------------------------------><------------
--D--D--E--N--D--E--E--E--Y--E--A--W--K--V--R--E--L--K--R--I--K--R--D--R--E--D--R--E--A--L--E--K--E-
TGATGATGAAAATGATGAGGAGGAATATGAGGCATGGAAAGTTCGAGAGCTAAAAAGAATCAAGAGGGACAGAGAAGATCGAGAAGCGCTTGAGAAGGAG
::::::::::::::::::::::::::::::.::::::::::::::.::::::::.:::::::::::::::::::::::: :::::   ::::::::::::
TGATGATGAAAATGATGAGGAGGAATATGAAGCATGGAAAGTTCGGGAGCTAAAGAGAATCAAGAGGGACAGAGAAGATAGAGAA---CTTGAGAAGGAG
--D--D--E--N--D--E--E--E--Y--E--A--W--K--V--R--E--L--K--R--I--K--R--D--R--E--D--R--E-----L--E--K--E-

----------------------------------------------------------------------------------------------------
-K--A--E--I--E--R--M--R--N--L--T--E--E--E--R--R--A--E--L--R--A--N--G--K--V--I--T--N--K--A--V--K--G--
AAAGCAGAAATTGAACGCATGCGAAACCTGACTGAGGAAGAGAGGAGAGCTGAACTTCGGGCAAACGGCAAAGTCATTACCAACAAAGCTGTTAAGGGCA
::::::::::::::::::::::::::::::::::::::::::::: :::::::.:::::::::::.::::::::::::::::::::::::::::::::::
AAAGCAGAAATTGAACGCATGCGAAACCTGACTGAGGAAGAGAGGCGAGCTGAGCTTCGGGCAAATGGCAAAGTCATTACCAACAAAGCTGTTAAGGGCA
-K--A--E--I--E--R--M--R--N--L--T--E--E--E--R--R--A--E--L--R--A--N--G--K--V--I--T--N--K--A--V--K--G--

----------------------------------------------><----------------------------------------------------
K--Y--K--F--L--Q--K--Y--Y--H--R--G--A--F--F--M--D--E--D--E--E--V--Y--K--R--D--F--S--A--P--T--L--E--D
AATACAAGTTCTTACAGAAGTATTATCACCGGGGTGCCTTCTTCATGGATGAGGATGAAGAAGTATACAAGAGAGATTTCAGCGCTCCTACCCTGGAGGA
::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::::::::
AATATAAGTTCTTACAGAAGTATTATCACCGGGGTGCCTTCTTCATGGATGAGGATGAAGAAGTATACAAGAGAGATTTCAGTGCACCTACCCTGGAGGA
K--Y--K--F--L--Q--K--Y--Y--H--R--G--A--F--F--M--D--E--D--E--E--V--Y--K--R--D--F--S--A--P--T--L--E--D

------------------------------------><--------------------------------------------------------------
--H--F--N--K--T--I--L--P--K--V--M--Q--V--K--N--F--G--R--S--G--R--T--K--Y--T--H--L--V--D--Q--D--T--T-
TCATTTCAATAAAACCATTCTTCCTAAAGTCATGCAGGTCAAGAACTTTGGACGCTCAGGTCGCACCAAATACACTCACCTTGTGGATCAAGATACCACC
:::::::::.::::::::::::::.:::::::::::::::::::::::::::::::: ::.::.::::::::.::.:::::.::::::::::::::::::
TCATTTCAACAAAACCATTCTTCCCAAAGTCATGCAGGTCAAGAACTTTGGACGCTCTGGCCGTACCAAATATACCCACCTCGTGGATCAAGATACCACC
--H--F--N--K--T--I--L--P--K--V--M--Q--V--K--N--F--G--R--S--G--R--T--K--Y--T--H--L--V--D--Q--D--T--T-

----------------------------------------------------------------------------------------------------
-S--F--D--S--A--W--G--Q--E--S--A--Q--N--T--K--F--F--K--Q--K--A--A--G--V--R--D--V--F--E--R--P--S--A--
TCCTTTGACTCAGCTTGGGGCCAAGAGAGTGCCCAGAACACAAAGTTCTTCAAACAAAAGGCAGCTGGGGTACGAGATGTATTTGAGCGGCCATCTGCCA
:::::::::::::: :::::::::::::::::::::::::::::::::::.::::::::.::::::::::::::::::::::::::.:::::.:::::::
TCCTTTGACTCAGCATGGGGCCAAGAGAGTGCCCAGAACACAAAGTTCTTTAAACAAAAAGCAGCTGGGGTACGAGATGTATTTGAACGGCCGTCTGCCA
-S--F--D--S--A--W--G--Q--E--S--A--Q--N--T--K--F--F--K--Q--K--A--A--G--V--R--D--V--F--E--R--P--S--A--

------------------->
K--K--R--K--T--T--*-
AGAAGCGGAAAACTACCTAG
::::::::::::::::.:::
AGAAGCGGAAAACTACTTAG
K--K--R--K--T--T--*-

Pig Consensus Sequence

>BGISUST0000881955
------------AGCGCACTCATGAAACAACCGCCTATTCAGTCTACGGCTGGGGCCGTCCCGGTTCGCAATGAGAAA---GAGATTTCGATGGAAAAAG
TGAAGGTAAAACGTTATGTGTCAGGAAAGAGGCCAGACTATGCCCCTATGGAGTCCTCAGATGAGGAGGATGAAGAATTTCAGTTCATTAAGAAAGCCAA
AGAACAAGAAGCAGAGCCTGAGGAACAAGAGGAGGATTCATCTAGTGACCCTCGGCTGCGACGTTTGCAGAACCGTATTAGTGAAGATGTGGAAGAG---
TTGGCTCGACATCGGAAAATAGTGGAACCCGAAGTGGTGGGAGAAAGTGACTCAGAAGTAGAAGGAGATGCTTGGCGCATGGAACGAGAAGATACCAGTG
AAGAAGAAGAAGAAGAGATTGATGATGAGGAAATAGAGCGACGCCGTGGCATGATGCGTCAACGAGCACAGGAGAGAAAAAATGAAGAGATGGAAGTCAT
GGAGGTGGAAGATGAGGGGCGTTCTGGGGAGGAGTCAGAATCAGAGTCTGAGTATGAAGAGTACACAGACAGTGAAGATGAGATGGAGCCTCGCCTTAAG
CCAGTCTTCATT------AAGGACCGAGTAACAGTTCAAGAACGGGAGGCCGAAGCATTGAAACAGAAGGAGCTGGAGCAGGAGGCCAAACGCATGGCTG
AGGAGAGACGCAAATATACACTCAAGATTGTAGAAGAAGAGACCAAGAAAGAGCTGGAGGAGAACAAGCGGTCCCTGGCTGCGCTAGATGCACTCAATAC
TGATGATGAAAATGATGAGGAGGAATATGAAGCATGGAAAGTTCGGGAGCTAAAGAGAATCAAGAGGGACAGAGAAGATAGAGAA---CTTGAGAAGGAG
AAAGCAGAAATTGAACGCATGCGAAACCTGACTGAGGAAGAGAGGCGAGCTGAGCTTCGGGCAAATGGCAAAGTCATTACCAACAAAGCTGTTAAGGGCA
AATATAAGTTCTTACAGAAGTATTATCACCGGGGTGCCTTCTTCATGGATGAGGATGAAGAAGTATACAAGAGAGATTTCAGTGCACCTACCCTGGAGGA
TCATTTCAACAAAACCATTCTTCCCAAAGTCATGCAGGTCAAGAACTTTGGACGCTCTGGCCGTACCAAATATACCCACCTCGTGGATCAAGATACCACC
TCCTTTGACTCAGCATGGGGCCAAGAGAGTGCCCAGAACACAAAGTTCTTTAAACAAAAAGCAGCTGGGGTACGAGATGTATTTGAACGGCCGTCTGCCA
AGAAGCGGAAAACTACTTAG


>BGISUSP0000881955
----SALMKQPPIQSTAGAVPVRNEK-EISMEKVKVKRYVSGKRPDYAPMESSDEEDEEFQFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEE-
LARHRKIVEPEVVGESDSEVEGDAWRMEREDTSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESESESEYEEYTDSEDEMEPRLK
PVFI--KDRVTVQEREAEALKQKELEQEAKRMAEERRKYTLKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDRE-LEKE
KAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTT
SFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKTT*