Sequences
EST Library Info
nje3Newborn 115 days, jejunum
plac3Unavailable
plun1Unavailable
uio5Unavailable
ute2Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000140284 (click for geneview)
Transcript ID ENST00000267842(link to ensembl)
Symbol SLC27A2
Localtion Chromosome:15:48261714:48315862:1 band: 15q21.2
Description Very-long-chain acyl-CoA synthetase (EC 6.2.1.-) (Very-long-chain- fatty-acid-CoA ligase). [Source:Uniprot/SWISSPROT;Acc:O14975]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--S--A--I--Y--T--V--L--A--G--L--L--F--L--P--L--L--V--N--L--C--C--P--Y--F--F--Q--D--I--G--Y--F--
ATGCTTTCCGCCATCTACACAGTCCTGGCGGGACTGCTGTTCCTGCCGCTCCTGGTGAACCTCTGCTGCCCATACTTCTTCCAGGACATAGGCTACTTCT
::::: .: :.:::::::.:.:.:::::::::. :::::.:::::::::: ::::::::.::::::::::: ::::::::: ::::: :...:::::::.
ATGCTGCCGGTCATCTACGCGGCCCTGGCGGGGGTGCTGCTCCTGCCGCTGCTGGTGAATCTCTGCTGCCCCTACTTCTTCGAGGACTTGAACTACTTCC
-M--L--P--V--I--Y--A--A--L--A--G--V--L--L--L--P--L--L--V--N--L--C--C--P--Y--F--F--E--D--L--N--Y--F--

----------------------------------------------------------------------------------------------------
L--K--V--A--A--V--G--R--R--V--R--S--Y--G--K--R--R--P--A--R--T--I--L--R--A--F--L--E--K--A--R--Q--T--P
TGAAGGTGGCCGCCGTGGGCCGGAGGGTGCGCAGCTACGGGAAGCGGCGGCCGGCGCGCACCATCCTGCGGGCGTTCCTGGAGAAAGCGCGCCAGACGCC
:::::::::::.  :::. :::: ::.::::::::::: :: :::: :::::.:.::.:::.:::::  . ::::::::::: :.:::::::::::: ::
TGAAGGTGGCCAGGGTGACCCGGCGGATGCGCAGCTACCGGCAGCGCCGGCCAGTGCACACTATCCTCAACGCGTTCCTGGATAGAGCGCGCCAGACCCC
L--K--V--A--R--V--T--R--R--M--R--S--Y--R--Q--R--R--P--V--H--T--I--L--N--A--F--L--D--R--A--R--Q--T--P

----------------------------------------------------------------------------------------------------
--H--K--P--F--L--L--F--R--D--E--T--L--T--Y--A--Q--V--D--R--R--S--N--Q--V--A--R--A--L--H--D--H--L--G-
ACACAAGCCTTTTCTGCTCTTCCGCGACGAGACTCTCACCTACGCGCAGGTGGACCGGCGCAGCAATCAAGTGGCCCGGGCGCTGCACGACCACCTCGGC
.:.:::::::::.::::::::::. :::::::: ::::::::.:::::::::::::::::::::::.:::::::: ::.:: ::::.:::::::::.:::
GCGCAAGCCTTTCCTGCTCTTCCAGGACGAGACGCTCACCTATGCGCAGGTGGACCGGCGCAGCAACCAAGTGGCGCGAGCTCTGCGCGACCACCTTGGC
--R--K--P--F--L--L--F--Q--D--E--T--L--T--Y--A--Q--V--D--R--R--S--N--Q--V--A--R--A--L--R--D--H--L--G-

----------------------------------------------------------------------------------------------------
-L--R--Q--G--D--C--V--A--L--L--M--G--N--E--P--A--Y--V--W--L--W--L--G--L--V--K--L--G--C--A--M--A--C--
CTGCGCCAGGGAGACTGCGTGGCGCTCCTTATGGGTAACGAGCCGGCCTACGTGTGGCTGTGGCTGGGGCTGGTGAAGCTGGGCTGTGCCATGGCGTGCC
:: :: :::::::::::::::::: ::.:.::::::::.::.:: ::.::.:::::::: :::::::::::::. :::::::::::::::::::::::::
CTCCGGCAGGGAGACTGCGTGGCGGTCTTCATGGGTAATGAACCCGCTTATGTGTGGCTCTGGCTGGGGCTGGCCAAGCTGGGCTGTGCCATGGCGTGCC
-L--R--Q--G--D--C--V--A--V--F--M--G--N--E--P--A--Y--V--W--L--W--L--G--L--A--K--L--G--C--A--M--A--C--

-----------------------------------------------------------------------------><---------------------
L--N--Y--N--I--R--A--K--S--L--L--H--C--F--Q--C--C--G--A--K--V--L--L--V--S--P--E--L--Q--A--A--V--E--E
TCAATTACAACATCCGCGCGAAGTCCCTGCTGCACTGCTTCCAGTGCTGCGGGGCGAAGGTGCTGCTGGTGTCGCCAGAACTACAAGCAGCTGTCGAAGA
::::.::::::::::::: ::::::::::.::::::::::::::::::::::::::::::::::.::::. ::::::   ::::::::::::.:.:::::
TCAACTACAACATCCGCGGGAAGTCCCTGTTGCACTGCTTCCAGTGCTGCGGGGCGAAGGTGCTACTGGCCTCGCCA---CTACAAGCAGCTATTGAAGA
L--N--Y--N--I--R--G--K--S--L--L--H--C--F--Q--C--C--G--A--K--V--L--L--A--S--P-----L--Q--A--A--I--E--E

----------------------------------------------------------------------------------------------------
--I--L--P--S--L--K--K--D--D--V--S--I--Y--Y--V--S--R--T--S--N--T--D--G--I--D--S--F--L--D--K--V--D--E-
GATACTGCCAAGCCTTAAAAAAGATGATGTGTCCATCTATTATGTGAGCAGAACTTCTAACACAGATGGGATTGACTCTTTCCTGGACAAAGTGGATGAA
:.:.::.:::::::: ::::::::::::::: ::::::::::..::::::::: :::::::::.::::::.:.:::::::::::.:::::::::::::::
GGTGCTACCAAGCCTGAAAAAAGATGATGTGGCCATCTATTACATGAGCAGAAGTTCTAACACGGATGGGGTCGACTCTTTCCTAGACAAAGTGGATGAA
--V--L--P--S--L--K--K--D--D--V--A--I--Y--Y--M--S--R--S--S--N--T--D--G--V--D--S--F--L--D--K--V--D--E-

---------------------------------------------------------------------------------------><-----------
-V--S--T--E--P--I--P--E--S--W--R--S--E--V--T--F--S--T--P--A--L--Y--I--Y--T--S--G--T--T--G--L--P--K--
GTATCAACTGAACCTATCCCAGAGTCATGGAGGTCTGAAGTCACTTTTTCCACTCCTGCCTTATACATTTATACTTCTGGAACCACAGGTCTTCCAAAAG
::.::::::::::: ::.:::::::: :::::::: :::::.: .:::::::::::::::.::::::::::::::::::::::::::             
GTGTCAACTGAACCAATTCCAGAGTCCTGGAGGTCGGAAGTTAACTTTTCCACTCCTGCCCTATACATTTATACTTCTGGAACCACA-------------
-V--S--T--E--P--I--P--E--S--W--R--S--E--V--N--F--S--T--P--A--L--Y--I--Y--T--S--G--T--T--------------

----------------------------------------------------------------------------------------------------
A--A--M--I--T--H--Q--R--I--W--Y--G--T--G--L--T--F--V--S--G--L--K--A--D--D--V--I--Y--I--T--L--P--F--Y
CAGCCATGATCACTCATCAGCGCATATGGTATGGAACTGGCCTCACTTTTGTAAGCGGATTGAAGGCAGATGATGTCATCTATATCACTCTGCCCTTTTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
--H--S--A--A--L--L--I--G--I--H--G--C--I--V--A--G--A--T--L--A--L--R--T--K--F--S--A--S--Q--F--W--D--D-
CCACAGTGCTGCACTACTGATTGGCATTCACGGATGTATTGTGGCTGGTGCTACTCTTGCCTTGCGGACTAAATTTTCAGCCAGCCAGTTTTGGGATGAC
                                                 ::::::.: :..::.:::::.::::::::::::::::: ::::::::::::
-------------------------------------------------GCTACTTTGGTTTTACGGACCAAATTTTCAGCCAGCCACTTTTGGGATGAC
--------------------------------------------------A--T--L--V--L--R--T--K--F--S--A--S--H--F--W--D--D-

-----------------------------------------------------------------------><---------------------------
-C--R--K--Y--N--V--T--V--I--Q--Y--I--G--E--L--L--R--Y--L--C--N--S--P--Q--K--P--N--D--R--D--H--K--V--
TGCAGAAAATACAACGTCACTGTCATTCAGTATATCGGTGAACTGCTTCGGTATTTATGCAACTCACCACAGAAACCAAATGACCGTGATCATAAAGTGA
:::::::::::.:: ::::::::::::::::::::::: :::::::::::::::::::::::::: :: ::::::::::::::.:::::.::::::::::
TGCAGAAAATATAAGGTCACTGTCATTCAGTATATCGGAGAACTGCTTCGGTATTTATGCAACTCTCCCCAGAAACCAAATGATCGTGACCATAAAGTGA
-C--R--K--Y--K--V--T--V--I--Q--Y--I--G--E--L--L--R--Y--L--C--N--S--P--Q--K--P--N--D--R--D--H--K--V--

----------------------------------------------------------------------------------------------------
R--L--A--L--G--N--G--L--R--G--D--V--W--R--Q--F--V--K--R--F--G--D--I--C--I--Y--E--F--Y--A--A--T--E--G
GACTGGCACTGGGAAATGGCTTACGAGGAGATGTGTGGAGACAATTTGTCAAGAGATTTGGGGACATATGCATCTATGAGTTCTATGCTGCCACTGAAGG
:: ::::  :::::::::::::.:::: ::::::::::::: ::::..::::::::::::::::::: ..::: :::::.::::::::: ::::::::::
GAATGGCCATGGGAAATGGCTTGCGAGCAGATGTGTGGAGAGAATTCATCAAGAGATTTGGGGACATTCACATATATGAATTCTATGCTTCCACTGAAGG
R--M--A--M--G--N--G--L--R--A--D--V--W--R--E--F--I--K--R--F--G--D--I--H--I--Y--E--F--Y--A--S--T--E--G

------------------------------------------------------------------><--------------------------------
--N--I--G--F--M--N--Y--A--R--K--V--G--A--V--G--R--V--N--Y--L--Q--K--K--I--I--T--Y--D--L--I--K--Y--D-
CAATATTGGATTTATGAATTATGCGAGAAAAGTTGGTGCTGTTGGAAGAGTAAACTACCTACAGAAAAAAATCATAACTTATGACCTGATTAAATATGAT
::::::.::::::::::::::..::::::::.::::::::::::::::::: ::::::::::::::::::.::.:::::::::: ::.::::::::::::
CAATATCGGATTTATGAATTACACGAGAAAAATTGGTGCTGTTGGAAGAGTTAACTACCTACAGAAAAAAGTCGTAACTTATGAACTAATTAAATATGAT
--N--I--G--F--M--N--Y--T--R--K--I--G--A--V--G--R--V--N--Y--L--Q--K--K--V--V--T--Y--E--L--I--K--Y--D-

---------------------------------------------------------><-----------------------------------------
-V--E--K--D--E--P--V--R--D--E--N--G--Y--C--V--R--V--P--K--G--E--V--G--L--L--V--C--K--I--T--Q--L--T--
GTGGAGAAAGATGAACCTGTCCGTGATGAAAATGGATATTGCGTCAGAGTTCCCAAAGGTGAAGTTGGACTTCTGGTTTGCAAAATCACACAACTTACAC
::::::::::::::::::::::: ::::.:::::::::.:::.:::.::::::::::   :::::::::::.:::::::::::::::::: : ::::: :
GTGGAGAAAGATGAACCTGTCCGAGATGGAAATGGATACTGCATCAAAGTTCCCAAA---GAAGTTGGACTCCTGGTTTGCAAAATCACAAATCTTACCC
-V--E--K--D--E--P--V--R--D--G--N--G--Y--C--I--K--V--P--K-----E--V--G--L--L--V--C--K--I--T--N--L--T--

----------------------------------------------------------------------------------------------------
P--F--N--G--Y--A--G--A--K--A--Q--T--E--K--K--K--L--R--D--V--F--K--K--G--D--L--Y--F--N--S--G--D--L--L
CATTTAATGGCTATGCTGGAGCAAAGGCTCAGACAGAGAAGAAAAAACTGAGAGATGTCTTTAAGAAAGGAGACCTCTATTTCAACAGTGGAGATCTCTT
::::::::::::::::.:::: ::::.::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::
CATTTAATGGCTATGCCGGAGGAAAGACTCAGACAGAGAAGAAAAAACTGAGAGATGTCTTTAAGAAAGGAGACGTCTATTTCAACAGTGGAGATCTCTT
P--F--N--G--Y--A--G--G--K--T--Q--T--E--K--K--K--L--R--D--V--F--K--K--G--D--V--Y--F--N--S--G--D--L--L

--------------------------------------------------------><------------------------------------------
--M--V--D--H--E--N--F--I--Y--F--H--D--R--V--G--D--T--F--R--W--K--G--E--N--V--A--T--T--E--V--A--D--T-
AATGGTTGACCATGAAAATTTCATCTATTTCCACGACAGAGTTGGAGATACATTCCGGTGGAAAGGGGAAAATGTGGCCACCACTGAAGTTGCTGATACA
::::.:::::::.::::::::.:::::.:::::.::::::::::::::::: :::   ::::::::::::::::::::::::::::::::.::::::..:
AATGATTGACCACGAAAATTTTATCTACTTCCATGACAGAGTTGGAGATACTTTC---TGGAAAGGGGAAAATGTGGCCACCACTGAAGTCGCTGATGTA
--M--I--D--H--E--N--F--I--Y--F--H--D--R--V--G--D--T--F-----W--K--G--E--N--V--A--T--T--E--V--A--D--V-

------------------------------------------------------><--------------------------------------------
-V--G--L--V--D--F--V--Q--E--V--N--V--Y--G--V--H--V--P--D--H--E--G--R--I--G--M--A--S--I--K--M--K--E--
GTTGGACTGGTTGATTTTGTCCAAGAAGTAAATGTTTATGGAGTGCATGTGCCAGATCATGAGGGTCGCATTGGCATGGCCTCCATCAAAATGAAAGAAA
:: ::: :::::::.::::::::.:::::.::::::::::: :::. :::.:::   ::.::.::::: :::::::::::::: :::::.:::::.::::
GTAGGAATGGTTGACTTTGTCCAGGAAGTGAATGTTTATGGCGTGTCTGTACCA---CACGAAGGTCGAATTGGCATGGCCTCAATCAAGATGAAGGAAA
-V--G--M--V--D--F--V--Q--E--V--N--V--Y--G--V--S--V--P-----H--E--G--R--I--G--M--A--S--I--K--M--K--E--

-------------------------------------------------------------------------------------><-------------
N--H--E--F--D--G--K--K--L--F--Q--H--I--A--D--Y--L--P--S--Y--A--R--P--R--F--L--R--I--Q--D--T--I--E--I
ACCATGAATTTGATGGAAAGAAACTCTTTCAGCACATTGCTGATTACCTACCTAGTTATGCAAGGCCCCGGTTTCTAAGAATACAGGACACCATTGAGAT
::::::::::::::::::::::::::::: ::::..: ::.::::::::.::.:.:::::::::::::::::::::::::::::::::::::::::::::
ACCATGAATTTGATGGAAAGAAACTCTTTAAGCATGTGGCCGATTACCTGCCCAATTATGCAAGGCCCCGGTTTCTAAGAATACAGGACACCATTGAGAT
N--H--E--F--D--G--K--K--L--F--K--H--V--A--D--Y--L--P--N--Y--A--R--P--R--F--L--R--I--Q--D--T--I--E--I

----------------------------------------------------------------------------------------------------
--T--G--T--F--K--H--R--K--M--T--L--V--E--E--G--F--N--P--A--V--I--K--D--A--L--Y--F--L--D--D--T--A--K-
CACTGGAACTTTTAAACACCGCAAAATGACCCTGGTGGAGGAGGGCTTTAACCCTGCTGTCATCAAAGATGCCTTGTATTTCTTGGATGACACAGCAAAA
::::::::::::::::::::: :::.::::::: :::::.::::::::::::::::: ::.:::::::::::::::::::::::::::::.: ::::.::
CACTGGAACTTTTAAACACCGAAAAGTGACCCTCGTGGAAGAGGGCTTTAACCCTGCGGTTATCAAAGATGCCTTGTATTTCTTGGATGATAAAGCAGAA
--T--G--T--F--K--H--R--K--V--T--L--V--E--E--G--F--N--P--A--V--I--K--D--A--L--Y--F--L--D--D--K--A--E-

-------------------------------------------------------------->
-M--Y--V--P--M--T--E--D--I--Y--N--A--I--S--A--K--T--L--K--L--*-
ATGTATGTGCCTATGACTGAGGACATCTATAATGCCATAAGTGCTAAAACCCTGAAACTCTGA
:.:::::::::::::::::::::.::.::.::::::::::.:: ::::.:.::::::::::::
ACGTATGTGCCTATGACTGAGGATATTTACAATGCCATAAATGATAAAGCTCTGAAACTCTGA
-T--Y--V--P--M--T--E--D--I--Y--N--A--I--N--D--K--A--L--K--L--*-

Pig Consensus Sequence

>BGISUST0000889002
ATGCTGCCGGTCATCTACGCGGCCCTGGCGGGGGTGCTGCTCCTGCCGCTGCTGGTGAATCTCTGCTGCCCCTACTTCTTCGAGGACTTGAACTACTTCC
TGAAGGTGGCCAGGGTGACCCGGCGGATGCGCAGCTACCGGCAGCGCCGGCCAGTGCACACTATCCTCAACGCGTTCCTGGATAGAGCGCGCCAGACCCC
GCGCAAGCCTTTCCTGCTCTTCCAGGACGAGACGCTCACCTATGCGCAGGTGGACCGGCGCAGCAACCAAGTGGCGCGAGCTCTGCGCGACCACCTTGGC
CTCCGGCAGGGAGACTGCGTGGCGGTCTTCATGGGTAATGAACCCGCTTATGTGTGGCTCTGGCTGGGGCTGGCCAAGCTGGGCTGTGCCATGGCGTGCC
TCAACTACAACATCCGCGGGAAGTCCCTGTTGCACTGCTTCCAGTGCTGCGGGGCGAAGGTGCTACTGGCCTCGCCA---CTACAAGCAGCTATTGAAGA
GGTGCTACCAAGCCTGAAAAAAGATGATGTGGCCATCTATTACATGAGCAGAAGTTCTAACACGGATGGGGTCGACTCTTTCCTAGACAAAGTGGATGAA
GTGTCAACTGAACCAATTCCAGAGTCCTGGAGGTCGGAAGTTAACTTTTCCACTCCTGCCCTATACATTTATACTTCTGGAACCACA-------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------GCTACTTTGGTTTTACGGACCAAATTTTCAGCCAGCCACTTTTGGGATGAC
TGCAGAAAATATAAGGTCACTGTCATTCAGTATATCGGAGAACTGCTTCGGTATTTATGCAACTCTCCCCAGAAACCAAATGATCGTGACCATAAAGTGA
GAATGGCCATGGGAAATGGCTTGCGAGCAGATGTGTGGAGAGAATTCATCAAGAGATTTGGGGACATTCACATATATGAATTCTATGCTTCCACTGAAGG
CAATATCGGATTTATGAATTACACGAGAAAAATTGGTGCTGTTGGAAGAGTTAACTACCTACAGAAAAAAGTCGTAACTTATGAACTAATTAAATATGAT
GTGGAGAAAGATGAACCTGTCCGAGATGGAAATGGATACTGCATCAAAGTTCCCAAA---GAAGTTGGACTCCTGGTTTGCAAAATCACAAATCTTACCC
CATTTAATGGCTATGCCGGAGGAAAGACTCAGACAGAGAAGAAAAAACTGAGAGATGTCTTTAAGAAAGGAGACGTCTATTTCAACAGTGGAGATCTCTT
AATGATTGACCACGAAAATTTTATCTACTTCCATGACAGAGTTGGAGATACTTTC---TGGAAAGGGGAAAATGTGGCCACCACTGAAGTCGCTGATGTA
GTAGGAATGGTTGACTTTGTCCAGGAAGTGAATGTTTATGGCGTGTCTGTACCA---CACGAAGGTCGAATTGGCATGGCCTCAATCAAGATGAAGGAAA
ACCATGAATTTGATGGAAAGAAACTCTTTAAGCATGTGGCCGATTACCTGCCCAATTATGCAAGGCCCCGGTTTCTAAGAATACAGGACACCATTGAGAT
CACTGGAACTTTTAAACACCGAAAAGTGACCCTCGTGGAAGAGGGCTTTAACCCTGCGGTTATCAAAGATGCCTTGTATTTCTTGGATGATAAAGCAGAA
ACGTATGTGCCTATGACTGAGGATATTTACAATGCCATAAATGATAAAGCTCTGAAACTCTGA


>BGISUSP0000889002
MLPVIYAALAGVLLLPLLVNLCCPYFFEDLNYFLKVARVTRRMRSYRQRRPVHTILNAFLDRARQTPRKPFLLFQDETLTYAQVDRRSNQVARALRDHLG
LRQGDCVAVFMGNEPAYVWLWLGLAKLGCAMACLNYNIRGKSLLHCFQCCGAKVLLASP-LQAAIEEVLPSLKKDDVAIYYMSRSSNTDGVDSFLDKVDE
VSTEPIPESWRSEVNFSTPALYIYTSGTT------------------------------------------------------ATLVLRTKFSASHFWDD
CRKYKVTVIQYIGELLRYLCNSPQKPNDRDHKVRMAMGNGLRADVWREFIKRFGDIHIYEFYASTEGNIGFMNYTRKIGAVGRVNYLQKKVVTYELIKYD
VEKDEPVRDGNGYCIKVPK-EVGLLVCKITNLTPFNGYAGGKTQTEKKKLRDVFKKGDVYFNSGDLLMIDHENFIYFHDRVGDTF-WKGENVATTEVADV
VGMVDFVQEVNVYGVSVP-HEGRIGMASIKMKENHEFDGKKLFKHVADYLPNYARPRFLRIQDTIEITGTFKHRKVTLVEEGFNPAVIKDALYFLDDKAE
TYVPMTEDIYNAINDKALKL*