Sequences
EST Library Info
fat2Fatt
Clusters
Oligos
SNPs

Gene ID ENSG00000140285 (click for geneview)
Transcript ID ENST00000267843(link to ensembl)
Symbol FGF7
Localtion Chromosome:15:47502751:47566815:1 band: 15q21.2
Description Keratinocyte growth factor precursor (KGF) (Fibroblast growth factor- 7) (FGF-7) (HBGF-7). [Source:Uniprot/SWISSPROT;Acc:P21781]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--H--K--W--I--L--T--W--I--L--P--T--L--L--Y--R--S--C--F--H--I--I--C--L--V--G--T--I--S--L--A--C--N--
ATGCACAAATGGATACTGACATGGATCCTGCCAACTTTGCTCTACAGATCATGCTTTCACATTATCTGTCTAGTGGGTACTATATCTTTAGCTTGCAATG
::::.::::::::::::::::::::::::::::: :::::::::::::::::::::.::::::::::::::.:::::.::: :::::::.:: :::::::
ATGCGCAAATGGATACTGACATGGATCCTGCCAAGTTTGCTCTACAGATCATGCTTCCACATTATCTGTCTGGTGGGCACTTTATCTTTGGCATGCAATG
-M--R--K--W--I--L--T--W--I--L--P--S--L--L--Y--R--S--C--F--H--I--I--C--L--V--G--T--L--S--L--A--C--N--

----------------------------------------------------------------------------------------------------
D--M--T--P--E--Q--M--A--T--N--V--N--C--S--S--P--E--R--H--T--R--S--Y--D--Y--M--E--G--G--D--I--R--V--R
ACATGACTCCAGAGCAAATGGCTACAAATGTGAACTGTTCCAGCCCTGAGCGACACACAAGAAGTTATGATTACATGGAAGGAGGGGATATAAGAGTGAG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::
ACATGACTCCAGAGCAAATGGCTACAAATGTGAACTGTTCCAGCCCTGAGCGACATACAAGAAGTTATGATTACATGGAAGGAGGGGATATAAGAGTGAG
D--M--T--P--E--Q--M--A--T--N--V--N--C--S--S--P--E--R--H--T--R--S--Y--D--Y--M--E--G--G--D--I--R--V--R

-------------------------------------------------------------------------------------><-------------
--R--L--F--C--R--T--Q--W--Y--L--R--I--D--K--R--G--K--V--K--G--T--Q--E--M--K--N--N--Y--N--I--M--E--I-
AAGACTCTTCTGTCGAACACAGTGGTACCTGAGGATCGATAAAAGAGGCAAAGTAAAAGGGACCCAAGAGATGAAGAATAATTACAATATCATGGAAATC
:::::::::::::::::::::::::::.::::::::.::.::: :::::::::: ::::::::.::::::::::::::.::::::   ::::::::::::
AAGACTCTTCTGTCGAACACAGTGGTATCTGAGGATTGACAAACGAGGCAAAGTCAAAGGGACTCAAGAGATGAAGAACAATTAC---ATCATGGAAATC
--R--L--F--C--R--T--Q--W--Y--L--R--I--D--K--R--G--K--V--K--G--T--Q--E--M--K--N--N--Y-----I--M--E--I-

-----------------------------------------------------------------------------------------><---------
-R--T--V--A--V--G--I--V--A--I--K--G--V--E--S--E--F--Y--L--A--M--N--K--E--G--K--L--Y--A--K--K--E--C--
AGGACAGTGGCAGTTGGAATTGTGGCAATCAAAGGGGTGGAAAGTGAATTCTATCTTGCAATGAACAAGGAAGGAAAACTCTATGCAAAGAAAGAATGCA
::::::   : . :  :.: :::.:::::::::::.::::::::::::: .:::::::::::::::::::::::::::::::::::::::::::::::::
AGGACA---GGGCTGTGGAATGTAGCAATCAAAGGAGTGGAAAGTGAATATTATCTTGCAATGAACAAGGAAGGAAAACTCTATGCAAAGAAAGAATGCA
-R--T-----G--L--W--N--V--A--I--K--G--V--E--S--E--Y--Y--L--A--M--N--K--E--G--K--L--Y--A--K--K--E--C--

----------------------------------------------------------------------------------------------------
N--E--D--C--N--F--K--E--L--I--L--E--N--H--Y--N--T--Y--A--S--A--K--W--T--H--N--G--G--E--M--F--V--A--L
ATGAAGATTGTAACTTCAAAGAACTAATTCTGGAAAACCATTACAACACATATGCATCAGCTAAATGGACACACAACGGAGGGGAAATGTTTGTTGCCTT
:::::::::::::::::::::::.:::::::::::::::::::::::::.:::::::::::::::::::::::::..:::::.:::::::::::::::::
ATGAAGATTGTAACTTCAAAGAATTAATTCTGGAAAACCATTACAACACGTATGCATCAGCTAAATGGACACACAGTGGAGGAGAAATGTTTGTTGCCTT
N--E--D--C--N--F--K--E--L--I--L--E--N--H--Y--N--T--Y--A--S--A--K--W--T--H--S--G--G--E--M--F--V--A--L

------------------------------------------------------------------------------------>
--N--Q--K--G--I--P--V--R--G--K--K--T--K--K--E--Q--K--T--A--H--F--L--P--M--A--I--T--*-
AAATCAAAAGGGGATTCCTGTAAGAGGAAAAAAAACGAAGAAAGAACAAAAAACAGCCCACTTTCTTCCTATGGCAATAACTTAA
:::::::::::::.:::::::::::::.:::::::: :::::::::::::::::::::::.::::::::::::::::::::.:::
AAATCAAAAGGGGGTTCCTGTAAGAGGGAAAAAAACCAAGAAAGAACAAAAAACAGCCCATTTTCTTCCTATGGCAATAACCTAA
--N--Q--K--G--V--P--V--R--G--K--K--T--K--K--E--Q--K--T--A--H--F--L--P--M--A--I--T--*-

Pig Consensus Sequence

>BGISUST0000893102
ATGCGCAAATGGATACTGACATGGATCCTGCCAAGTTTGCTCTACAGATCATGCTTCCACATTATCTGTCTGGTGGGCACTTTATCTTTGGCATGCAATG
ACATGACTCCAGAGCAAATGGCTACAAATGTGAACTGTTCCAGCCCTGAGCGACATACAAGAAGTTATGATTACATGGAAGGAGGGGATATAAGAGTGAG
AAGACTCTTCTGTCGAACACAGTGGTATCTGAGGATTGACAAACGAGGCAAAGTCAAAGGGACTCAAGAGATGAAGAACAATTAC---ATCATGGAAATC
AGGACAGGGCTGTGGAATGTAGCAATCAAAGGAGTGGAAAGTGAATATTATCTTGCAATGAACAAGGAAGGAAAACTCTATGCAAAGAAAGAATGCAATG
AAGATTGTAACTTCAAAGAATTAATTCTGGAAAACCATTACAACACGTATGCATCAGCTAAATGGACACACAGTGGAGGAGAAATGTTTGTTGCCTTAAA
TCAAAAGGGGGTTCCTGTAAGAGGGAAAAAAACCAAGAAAGAACAAAAAACAGCCCATTTTCTTCCTATGGCAATAACCTAA


>BGISUSP0000893102
MRKWILTWILPSLLYRSCFHIICLVGTLSLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNY-IMEI
RTGLWNVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTKKEQKTAHFLPMAIT*