Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000140287 (click for geneview)
Transcript ID ENST00000267845(link to ensembl)
Symbol HDC
Localtion Chromosome:15:48321443:48345214:-1 band: 15q21.2
Description Histidine decarboxylase (EC 4.1.1.22) (HDC). [Source:Uniprot/SWISSPROT;Acc:P19113]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------><--------------------------------------------------------------------
-M--M--E--P--E--E--Y--R--E--R--G--R--E--M--V--D--Y--I--C--Q--Y--L--S--T--V--R--E--R--R--V--T--P--D--
ATGATGGAGCCTGAGGAGTACAGAGAGAGAGGGAGAGAGATGGTGGATTACATCTGCCAGTACCTGAGCACTGTGCGGGAGAGACGTGTGACGCCAGACG
                                 :..::::::::::::::::::::::::::::::::::::::::::::: :.:::::::: :::::.:
---------------------------------AAGGAGATGGTGGATTACATCTGCCAGTACCTGAGCACTGTGCGGGAGCGGCGTGTGACTCCAGATG
----------------------------------K--E--M--V--D--Y--I--C--Q--Y--L--S--T--V--R--E--R--R--V--T--P--D--

----------------------------------------------------------------------------------------------------
V--Q--P--G--Y--L--R--A--Q--L--P--E--S--A--P--E--D--P--D--S--W--D--S--I--F--G--D--I--E--R--I--I--M--P
TGCAGCCTGGCTACCTGCGAGCCCAGCTGCCTGAGAGTGCTCCTGAGGACCCCGACAGCTGGGACAGCATCTTTGGGGACATTGAACGAATCATCATGCC
:: ..:::::::::::::::: ::::::::: ::: :::::::.::::: ::.:::::::::::::::::::::::.::::: ::.::::::::::::::
TGAGACCTGGCTACCTGCGAGGCCAGCTGCCGGAGCGTGCTCCCGAGGAGCCTGACAGCTGGGACAGCATCTTTGGAGACATAGAGCGAATCATCATGCC
V--R--P--G--Y--L--R--G--Q--L--P--E--R--A--P--E--E--P--D--S--W--D--S--I--F--G--D--I--E--R--I--I--M--P

---><-----------------------------------------------------------------------------------------------
--G--V--V--H--W--Q--S--P--H--M--H--A--Y--Y--P--A--L--T--S--W--P--S--L--L--G--D--M--L--A--D--A--I--N-
TGGGGTGGTACATTGGCAGAGCCCCCATATGCACGCCTACTACCCAGCCCTCACCTCTTGGCCCTCCCTGCTAGGAGACATGCTGGCTGATGCCATCAAC
::::::::::::::::::.:::::::::::::::::::::::::::::.:::::::::::::: :: :::::.:::::::::::::::::::::::.:::
TGGGGTGGTACATTGGCAAAGCCCCCATATGCACGCCTACTACCCAGCTCTCACCTCTTGGCCATCACTGCTGGGAGACATGCTGGCTGATGCCATTAAC
--G--V--V--H--W--Q--S--P--H--M--H--A--Y--Y--P--A--L--T--S--W--P--S--L--L--G--D--M--L--A--D--A--I--N-

-----------------><---------------------------------------------------------------------------------
-C--L--G--F--T--W--A--S--S--P--A--C--T--E--L--E--M--N--V--M--D--W--L--A--K--M--L--G--L--P--E--H--F--
TGCTTGGGATTCACCTGGGCATCCAGCCCTGCGTGTACAGAGCTGGAGATGAACGTCATGGACTGGTTGGCAAAAATGCTGGGACTTCCAGAGCACTTCT
:::::::::::::::::::: ::::::::::.:::.:::::.::::::::::::::::::::::::.:::::::::::::::::::.:: :: :::::::
TGCTTGGGATTCACCTGGGCTTCCAGCCCTGTGTGCACAGAACTGGAGATGAACGTCATGGACTGGCTGGCAAAAATGCTGGGACTCCCTGACCACTTCT
-C--L--G--F--T--W--A--S--S--P--V--C--T--E--L--E--M--N--V--M--D--W--L--A--K--M--L--G--L--P--D--H--F--

-------------------------------------------><-------------------------------------------------------
L--H--H--H--P--S--S--Q--G--G--G--V--L--Q--S--T--V--S--E--S--T--L--I--A--L--L--A--A--R--K--N--K--I--L
TGCACCACCACCCCAGCAGCCAGGGCGGAGGCGTCCTGCAGAGCACGGTCAGTGAATCCACTTTGATTGCCCTGCTGGCAGCAAGGAAGAACAAAATCCT
:::::::.:::::::::::::: :: :::::::::.::::::::::.::::::::.:::::.:::::.:::.::.:::::::: ::::::::::::::::
TGCACCATCACCCCAGCAGCCA-GGGGGAGGCGTCTTGCAGAGCACAGTCAGTGAGTCCACCTTGATCGCCTTGTTGGCAGCACGGAAGAACAAAATCCT
L--H--H--H--P--S--S--Q--G--G--G--V--L--Q--S--T--V--S--E--S--T--L--I--A--L--L--A--A--R--K--N--K--I--L

------------------------------------------------------------------------------><--------------------
--E--M--K--T--S--E--P--D--A--D--E--S--C--L--N--A--R--L--V--A--Y--A--S--D--Q--A--H--S--S--V--E--K--A-
GGAAATGAAAACGTCTGAGCCCGATGCTGATGAGTCCTGCCTAAATGCCCGACTCGTGGCCTATGCCTCTGACCAGGCTCACTCCTCTGTGGAAAAGGCT
::::::::::.:.::::::::.:. :: ::::::::::::::.::::::::.:::.: :::::::::::.::::::::.:::::::: ::::::::::::
GGAAATGAAAGCATCTGAGCCTGGGGCAGATGAGTCCTGCCTGAATGCCCGGCTCATCGCCTATGCCTCCGACCAGGCCCACTCCTCAGTGGAAAAGGCT
--E--M--K--A--S--E--P--G--A--D--E--S--C--L--N--A--R--L--I--A--Y--A--S--D--Q--A--H--S--S--V--E--K--A-

----------------------------------------------------------------------------------------------------
-G--L--I--S--L--V--K--M--K--F--L--P--V--D--D--N--F--S--L--R--G--E--A--L--Q--K--A--I--E--E--D--K--Q--
GGTTTGATTTCCCTTGTGAAGATGAAATTTCTGCCTGTGGATGACAACTTCTCACTCCGAGGGGAAGCTCTTCAGAAGGCCATCGAGGAAGACAAGCAGC
:::.:::::::.:: :: :::::::::::::::::::::::::::::::::::.:::::.:::::::::::::::::.:::::.:::::.::::.: :::
GGTCTGATTTCTCTGGTCAAGATGAAATTTCTGCCTGTGGATGACAACTTCTCGCTCCGGGGGGAAGCTCTTCAGAAAGCCATTGAGGAGGACAGGGAGC
-G--L--I--S--L--V--K--M--K--F--L--P--V--D--D--N--F--S--L--R--G--E--A--L--Q--K--A--I--E--E--D--R--E--

----------------------><--------------------------------------------------------------------><------
R--G--L--V--P--V--F--V--C--A--T-----L--G--T--T--G--V--C--A--F--D--C--L--S--E--L--G--P--I--C--A--R--E
GGGGCTTGGTGCCCGTCTTTGTCTGTGCAACA---CTAGGGACCACTGGGGTCTGTGCATTTGACTGCCTGTCAGAGCTGGGCCCCATCTGTGCCCGTGA
:::::::::::::.::::::::::::::::::   ::.:::::::::::::::::::::::::::::::::::.:::::::::::::::   ::: :.::
GGGGCTTGGTGCCTGTCTTTGTCTGTGCAACAA--CTGGGGACCACTGGGGTCTGTGCATTTGACTGCCTGTCGGAGCTGGGCCCCATC---GCCAGCGA
R--G--L--V--P--V--F--V--C--A--T--\--L--G--T--T--G--V--C--A--F--D--C--L--S--E--L--G--P--I-----A--S--E

----------------------------------------------------------------------------------------------------
--G--L--W--L--H--I--D--A--A--Y--A--G--T--A--F--L--C--P--E--F--R--G--F--L--K--G--I--E--Y--A--D--S--F-
GGGGCTGTGGCTCCACATCGATGCTGCTTATGCAGGCACTGCCTTCCTGTGCCCCGAGTTCCGGGGGTTTCTGAAGGGGATTGAGTATGCCGACTCCTTC
:::::::::::::::::::::::::::.::.::::::::.:::::::::::::::::::::::::::::::::::::: ::.:::::.::.::.::::::
GGGGCTGTGGCTCCACATCGATGCTGCCTACGCAGGCACCGCCTTCCTGTGCCCCGAGTTCCGGGGGTTTCTGAAGGGCATCGAGTACGCTGATTCCTTC
--G--L--W--L--H--I--D--A--A--Y--A--G--T--A--F--L--C--P--E--F--R--G--F--L--K--G--I--E--Y--A--D--S--F-

-------------------------------------------------------><-------------------------------------------
-T--F--N--P--S--K--W--M--M--V--H--F--D--C--T--G--F--W--V--K--D--K--Y--K--L--Q--Q--T--F--S--V--N--P--
ACCTTTAATCCTTCCAAGTGGATGATGGTGCATTTTGACTGTACTGGGTTCTGGGTCAAGGACAAGTACAAGCTGCAGCAGACCTTCAGTGTGAATCCCA
:: :::::::::::.:::::::::::::::::.::::::::::::::::::   ::::::::::::::::::::.::::::::::::::.:::::.::..
ACGTTTAATCCTTCTAAGTGGATGATGGTGCACTTTGACTGTACTGGGTTC---GTCAAGGACAAGTACAAGCTACAGCAGACCTTCAGCGTGAACCCTG
-T--F--N--P--S--K--W--M--M--V--H--F--D--C--T--G--F-----V--K--D--K--Y--K--L--Q--Q--T--F--S--V--N--P--

----------------------------------------------><----------------------------------------------------
I--Y--L--R--H--A--N--S--G--V--A--T--D--F--M--H--W--Q--I--P--L--S--R--R--F--R--S--V--K--L--W--F--V--I
TCTACCTCAGGCATGCCAACTCAGGCGTGGCCACCGACTTCATGCACTGGCAGATCCCCCTGAGCCGACGGTTTCGCTCTGTTAAACTCTGGTTCGTGAT
::::::::::::::::::::::.::::.::::::::::::::::::::::::::: ::.::::::::.::::::::::::.:::::::::::::.:::::
TCTACCTCAGGCATGCCAACTCGGGCGCGGCCACCGACTTCATGCACTGGCAGATACCTCTGAGCCGGCGGTTTCGCTCTATTAAACTCTGGTTTGTGAT
V--Y--L--R--H--A--N--S--G--A--A--T--D--F--M--H--W--Q--I--P--L--S--R--R--F--R--S--I--K--L--W--F--V--I

---------------------------------------------><-----------------------------------------------------
--R--S--F--G--V--K--N--L--Q--A--H--V--R--H--G--T--E--M--A--K--Y--F--E--S--L--V--R--N--D--P--S--F--E-
TCGGTCCTTCGGGGTGAAGAATCTTCAAGCACATGTCAGACATGGTACTGAAATGGCTAAATATTTTGAATCTCTGGTCAGAAACGACCCTTCCTTTGAA
:::::::::.::::::::::::::::::::.::.::.::::::::::.:::::::::::::::::::::::::.::::::::::.:::::::.:::::::
TCGGTCCTTTGGGGTGAAGAATCTTCAAGCGCACGTTAGACATGGTATTGAAATGGCTAAATATTTTGAATCTTTGGTCAGAAATGACCCTTTCTTTGAA
--R--S--F--G--V--K--N--L--Q--A--H--V--R--H--G--I--E--M--A--K--Y--F--E--S--L--V--R--N--D--P--F--F--E-

-----------------------------------------------><---------------------------------------------------
-I--P--A--K--R--H--L--G--L--V--V--F--R--L--K--G--P--N--C--L--T--E--N--V--L--K--E--I--A--K--A--G--R--
ATTCCTGCCAAGAGGCACCTTGGCCTGGTGGTTTTTCGTCTAAAGGGTCCTAATTGTCTCACAGAAAATGTGTTAAAGGAAATAGCTAAAGCTGGCCGTC
::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::: ::::.::::.::::::::::::::::::::::::.::
ATTCCTGCCAAGAGGCACCTCGGCCTGGTGGTTTTTCGTCTAAAGGGTCCTAATTGTCTCACCGAAAGTGTGCTAAAGGAAATAGCTAAAGCTGGCCATC
-I--P--A--K--R--H--L--G--L--V--V--F--R--L--K--G--P--N--C--L--T--E--S--V--L--K--E--I--A--K--A--G--H--

----------------------------------------------------------------------------------------------------
L--F--L--I--P--A--T--I--Q--D--K--L--I--I--R--F--T--V--T--S--Q--F--T--T--R--D--D--I--L--R--D--W--N--L
TCTTCCTCATCCCGGCCACTATCCAGGACAAGTTAATCATCCGTTTCACTGTGACATCCCAGTTTACCACTAGGGATGACATCCTGAGAGACTGGAATCT
:::::::::::::.::::: ::::::::::::::.:::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::.::
TCTTCCTCATCCCAGCCACGATCCAGGACAAGTTGATCATCCGTTTCACTGTGACATCCCAGTTCACCACCAGGGATGACATCCTGAGAGACTGGAACCT
L--F--L--I--P--A--T--I--Q--D--K--L--I--I--R--F--T--V--T--S--Q--F--T--T--R--D--D--I--L--R--D--W--N--L

----------------------------------------------------------------------------------------------------
--I--R--D--A--A--T--L--I--L--S--Q--H--C--T--S--Q--P--S--P--R--V--G--N--L--I--S--Q--I--R--G--A--R--A-
CATTCGAGATGCTGCCACTCTCATCCTGAGTCAGCACTGTACTTCCCAACCCAGCCCTCGGGTTGGGAACCTCATCTCCCAAATCAGGGGTGCCAGAGCC
:::::. :::::.:::::::::::::::::::::::.:::::::::::.::.::::::::: : ::::::::::::.::::::.: .:::. ::::::::
CATTCATGATGCCGCCACTCTCATCCTGAGTCAGCATTGTACTTCCCAGCCTAGCCCTCGGCTGGGGAACCTCATCCCCCAAACCCAGGGCCCCAGAGCC
--I--H--D--A--A--T--L--I--L--S--Q--H--C--T--S--Q--P--S--P--R--L--G--N--L--I--P--Q--T--Q--G--P--R--A-

----------------------------------------------------------------------------------------------------
-W--A--C--G--T--S--L--Q--S--V--S--G--A--G--D--D--P--V--Q--A--R--K--I--I--K--Q--P--Q--R--V--G--A--G--
TGGGCCTGTGGAACGTCCCTTCAGTCTGTCAGTGGGGCAGGAGATGATCCAGTCCAGGCCAGGAAGATCATCAAGCAGCCTCAGCGTGTGGGAGCCGGTC
: :::: . :.::.::::.::: .:::::::..:::::::.::::::.::::.::::::::::::::::::::.:::::::: : :::::::::::.:::
TTGGCCAAGGAAATGTCCTTTCCATCTGTCAACGGGGCAGAAGATGACCCAGCCCAGGCCAGGAAGATCATCAGGCAGCCTCCGAGTGTGGGAGCCAGTC
-L--A--K--E--M--S--F--P--S--V--N--G--A--E--D--D--P--A--Q--A--R--K--I--I--R--Q--P--P--S--V--G--A--S--

----------------------------------------------------------------------------------------------------
P--M--K--R--E--N--G--L--H--L--E--T--L--L--D--P--V--D--D--C--F--S--E--E--A--P--D--A--T--K--H--K--L--S
CCATGAAAAGGGAAAATGGCCTCCATCTTGAAACCCTGCTGGACCCAGTTGATGACTGCTTTTCAGAAGAGGCCCCAGATGCCACCAAGCACAAGCTGTC
...:::.:.:::.:..:.::. .::::::::::.::::: ::::::: ::::::::::::::::::::::::.::::::::.::::::::::::::::::
TTGTGAGAGGGGGAGGTAGCTGTCATCTTGAAATCCTGCAGGACCCATTTGATGACTGCTTTTCAGAAGAGGTCCCAGATGTCACCAAGCACAAGCTGTC
L--V--R--G--G--G--S--C--H--L--E--I--L--Q--D--P--F--D--D--C--F--S--E--E--V--P--D--V--T--K--H--K--L--S

----------------------------------------------------------------------------------------------------
--S--F--L--F--S--Y--L--S--V--Q--T--K--K--K--T--V--R--S--L--S--C--N--S--V--P--V--S--A--Q--K--P--L--P-
CTCCTTCCTGTTCAGTTACTTGTCTGTGCAGACTAAGAAGAAGACGGTGCGCTCCCTCAGTTGCAACAGTGTGCCAGTGAGTGCTCAGAAGCCACTGCCC
::::::..::::::::::.::::::::::::: ::::::::::.:.:::::.::::::::.::::::::.::::: ::.:::::::::::::::::::::
CTCCTTTTTGTTCAGTTATTTGTCTGTGCAGAATAAGAAGAAGGCAGTGCGTTCCCTCAGCTGCAACAGCGTGCCTGTAAGTGCTCAGAAGCCACTGCCC
--S--F--L--F--S--Y--L--S--V--Q--N--K--K--K--A--V--R--S--L--S--C--N--S--V--P--V--S--A--Q--K--P--L--P-

----------------------------------------------------------------------------------------------------
-T--E--A--S--V--K--N--G--G--S--S--R--V--R--I--F--S--R--F--P--E--D--M--M--M--L--K--K--S--A--F--K--K--
ACAGAGGCCTCTGTGAAGAATGGGGGCTCCTCCAGGGTCAGAATCTTTTCCAGGTTTCCAGAAGACATGATGATGCTGAAGAAAAGTGCCTTCAAAAAAC
::::: : ::::::::::::::: ::::::::: ::::.:::::::::::.::::::::.::::: ::::::.::::.::::::::::::::::::::::
ACAGATGGCTCTGTGAAGAATGGCGGCTCCTCCCGGGTTAGAATCTTTTCTAGGTTTCCGGAAGAGATGATGGTGCTAAAGAAAAGTGCCTTCAAAAAAC
-T--D--G--S--V--K--N--G--G--S--S--R--V--R--I--F--S--R--F--P--E--E--M--M--V--L--K--K--S--A--F--K--K--

--------------------------------------------------------------------------------------------
L--I--K--F--Y--S--V--P--S--F--P--E--C--S--S--Q--C--G--L--Q--L--P--C--C--P--L--Q--A--M--V--*-
TCATCAAATTCTACAGCGTCCCCAGCTTTCCTGAATGCAGCTCTCAATGTGGACTCCAGCTGCCCTGTTGCCCTCTGCAGGCCATGGTTTAG
: :::::.::::::::.:::::::::::::::::::::::::::::::::::..:::::::::::::.:::::.:::::::: :::::::::
TAATCAAGTTCTACAGTGTCCCCAGCTTTCCTGAATGCAGCTCTCAATGTGGGTTCCAGCTGCCCTGCTGCCCCCTGCAGGCAATGGTTTAG
L--I--K--F--Y--S--V--P--S--F--P--E--C--S--S--Q--C--G--F--Q--L--P--C--C--P--L--Q--A--M--V--*-

Pig Consensus Sequence

>BGISUST0000878013
---------------------------------AAGGAGATGGTGGATTACATCTGCCAGTACCTGAGCACTGTGCGGGAGCGGCGTGTGACTCCAGATG
TGAGACCTGGCTACCTGCGAGGCCAGCTGCCGGAGCGTGCTCCCGAGGAGCCTGACAGCTGGGACAGCATCTTTGGAGACATAGAGCGAATCATCATGCC
TGGGGTGGTACATTGGCAAAGCCCCCATATGCACGCCTACTACCCAGCTCTCACCTCTTGGCCATCACTGCTGGGAGACATGCTGGCTGATGCCATTAAC
TGCTTGGGATTCACCTGGGCTTCCAGCCCTGTGTGCACAGAACTGGAGATGAACGTCATGGACTGGCTGGCAAAAATGCTGGGACTCCCTGACCACTTCT
TGCACCATCACCCCAGCAGcgGGGGAGGCGTCTTGCAGAGCACAGTCAGTGAGTCCACCTTGATCGCCTTGTTGGCAGCACGGAAGAACAAAATCCTGGA
AATGAAAGCATCTGAGCCTGGGGCAGATGAGTCCTGCCTGAATGCCCGGCTCATCGCCTATGCCTCCGACCAGGCCCACTCCTCAGTGGAAAAGGCTGGT
CTGATTTCTCTGGTCAAGATGAAATTTCTGCCTGTGGATGACAACTTCTCGCTCCGGGGGGAAGCTCTTCAGAAAGCCATTGAGGAGGACAGGGAGCGGG
GCTTGGTGCCTGTCTTTGTCTGTGCAACacTGGGGACCACTGGGGTCTGTGCATTTGACTGCCTGTCGGAGCTGGGCCCCATC---GCCAGCGAGGGGCT
GTGGCTCCACATCGATGCTGCCTACGCAGGCACCGCCTTCCTGTGCCCCGAGTTCCGGGGGTTTCTGAAGGGCATCGAGTACGCTGATTCCTTCACGTTT
AATCCTTCTAAGTGGATGATGGTGCACTTTGACTGTACTGGGTTC---GTCAAGGACAAGTACAAGCTACAGCAGACCTTCAGCGTGAACCCTGTCTACC
TCAGGCATGCCAACTCGGGCGCGGCCACCGACTTCATGCACTGGCAGATACCTCTGAGCCGGCGGTTTCGCTCTATTAAACTCTGGTTTGTGATTCGGTC
CTTTGGGGTGAAGAATCTTCAAGCGCACGTTAGACATGGTATTGAAATGGCTAAATATTTTGAATCTTTGGTCAGAAATGACCCTTTCTTTGAAATTCCT
GCCAAGAGGCACCTCGGCCTGGTGGTTTTTCGTCTAAAGGGTCCTAATTGTCTCACCGAAAGTGTGCTAAAGGAAATAGCTAAAGCTGGCCATCTCTTCC
TCATCCCAGCCACGATCCAGGACAAGTTGATCATCCGTTTCACTGTGACATCCCAGTTCACCACCAGGGATGACATCCTGAGAGACTGGAACCTCATTCA
TGATGCCGCCACTCTCATCCTGAGTCAGCATTGTACTTCCCAGCCTAGCCCTCGGCTGGGGAACCTCATCCCCCAAACCCAGGGCCCCAGAGCCTTGGCC
AAGGAAATGTCCTTTCCATCTGTCAACGGGGCAGAAGATGACCCAGCCCAGGCCAGGAAGATCATCAGGCAGCCTCCGAGTGTGGGAGCCAGTCTTGTGA
GAGGGGGAGGTAGCTGTCATCTTGAAATCCTGCAGGACCCATTTGATGACTGCTTTTCAGAAGAGGTCCCAGATGTCACCAAGCACAAGCTGTCCTCCTT
TTTGTTCAGTTATTTGTCTGTGCAGAATAAGAAGAAGGCAGTGCGTTCCCTCAGCTGCAACAGCGTGCCTGTAAGTGCTCAGAAGCCACTGCCCACAGAT
GGCTCTGTGAAGAATGGCGGCTCCTCCCGGGTTAGAATCTTTTCTAGGTTTCCGGAAGAGATGATGGTGCTAAAGAAAAGTGCCTTCAAAAAACTAATCA
AGTTCTACAGTGTCCCCAGCTTTCCTGAATGCAGCTCTCAATGTGGGTTCCAGCTGCCCTGCTGCCCCCTGCAGGCAATGGTTTAG


>BGISUSP0000878013
-----------KEMVDYICQYLSTVRERRVTPDVRPGYLRGQLPERAPEEPDSWDSIFGDIERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAIN
CLGFTWASSPVCTELEMNVMDWLAKMLGLPDHFLHHHPSSGGGVLQSTVSESTLIALLAARKNKILEMKASEPGADESCLNARLIAYASDQAHSSVEKAG
LISLVKMKFLPVDDNFSLRGEALQKAIEEDRERGLVPVFVCATLGTTGVCAFDCLSELGPI-ASEGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTF
NPSKWMMVHFDCTGF-VKDKYKLQQTFSVNPVYLRHANSGAATDFMHWQIPLSRRFRSIKLWFVIRSFGVKNLQAHVRHGIEMAKYFESLVRNDPFFEIP
AKRHLGLVVFRLKGPNCLTESVLKEIAKAGHLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIHDAATLILSQHCTSQPSPRLGNLIPQTQGPRALA
KEMSFPSVNGAEDDPAQARKIIRQPPSVGASLVRGGGSCHLEILQDPFDDCFSEEVPDVTKHKLSSFLFSYLSVQNKKKAVRSLSCNSVPVSAQKPLPTD
GSVKNGGSSRVRIFSRFPEEMMVLKKSAFKKLIKFYSVPSFPECSSQCGFQLPCCPLQAMV*