Sequences
EST Library Info
nmm3Newborn 115 days, mucosal membranes
Clusters
Oligos
SNPs

Gene ID ENSG00000141013 (click for geneview)
Transcript ID ENST00000268699(link to ensembl)
Symbol GAS8
Localtion Chromosome:16:88616509:88638880:1 band: 16q24.3
Description Growth-arrest-specific protein 8 (Growth arrest-specific 11). [Source:Uniprot/SWISSPROT;Acc:O95995]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-><-------------------------------------------------------------------------------------><---------
-M--A--P--K--K--K--G--K--K--G--K--A--K--G--T--P--I--V--D--G--L--A--P--E--D--M--S--K--E--Q--V--E--E--
ATGGCACCGAAAAAGAAAGGGAAGAAAGGCAAAGCCAAAGGCACCCCGATTGTCGATGGGCTCGCTCCAGAGGACATGAGCAAGGAGCAGGTGGAGGAGC
   ::.:: ::: .::::::::::::::: ::.::::.:::::::::::.:::.::.:::::.:::::.:::::::::::::::::::::          
---GCGCCCAAACGGAAAGGGAAGAAAGGGAAGGCCAGAGGCACCCCGACTGTTGACGGGCTTGCTCCGGAGGACATGAGCAAGGAGCAG----------
----A--P--K--R--K--G--K--K--G--K--A--R--G--T--P--T--V--D--G--L--A--P--E--D--M--S--K--E--Q-----------

----------------------------------------------------------------------------------------------------
H--V--S--R--I--R--E--E--L--D--R--E--R--E--E--R--N--Y--F--Q--L--E--R--D--K--I--H--T--F--W--E--I--T--R
ATGTCAGCCGCATCCGGGAGGAGCTGGACCGCGAGCGGGAGGAACGAAACTACTTCCAGCTGGAGCGGGACAAGATCCACACCTTCTGGGAGATCACACG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------><-----------
--R--Q--L--E--E--K--K--A--E--L--R--N--K--D--R--E--M--E--E--A--E--E--R--H--Q--V--E--I--K--V--Y--K--Q-
GAGGCAGCTGGAGGAGAAGAAGGCTGAGCTGCGGAACAAAGACCGGGAGATGGAAGAAGCCGAGGAGAGGCACCAGGTGGAGATCAAGGTGTACAAGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--V--K--H--L--L--Y--E--H--Q--N--N--L--T--E--M--K--A--E--G--T--V--V--M--K--L--A--Q--K--E--H--R--I--
AAAGTGAAGCACCTGCTATATGAGCACCAGAACAACCTGACAGAGATGAAGGCTGAGGGCACTGTAGTCATGAAGCTGGCACAGAAAGAGCACCGCATAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------><----
Q--E--S--V--L--R--K--D--M--R--A--L--K--V--E--L--K--E--Q--E--L--A--S--E--V--V--V--K--N--L--R--L--K--H
AGGAGAGTGTGCTGCGCAAGGACATGCGGGCACTGAAGGTGGAGCTCAAGGAGCAGGAGCTGGCCAGTGAGGTGGTGGTGAAGAACCTGCGGCTGAAACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------><-------------------------------------------------
--T--E--E--I--T--R--M--R--N--D--F--E--R--Q--V--R--E--I--E--A--K--Y--D--K--K--M--K--M--L--R--D--E--L-
CACCGAGGAGATCACCAGGATGCGGAATGATTTTGAGAGGCAAGTTCGAGAAATTGAGGCCAAGTATGATAAGAAGATGAAGATGCTGAGGGACGAACTC
                                                    ::.:::::::::::.::.:::::::::::::::::  :::::::.::.
----------------------------------------------------ATCGAGGCCAAGTACGACAAGAAGATGAAGATGCTTCGGGACGAGCTT
-----------------------------------------------------I--E--A--K--Y--D--K--K--M--K--M--L--R--D--E--L-

----------------------------------------------------------------------------------------------------
-D--L--R--R--K--T--E--L--H--E--V--E--E--R--K--N--G--Q--I--H--T--L--M--Q--R--H--E--E--A--F--T--D--I--
GACTTGCGGAGAAAGACTGAGCTCCACGAAGTGGAGGAGAGGAAGAATGGCCAGATCCACACGCTGATGCAGCGCCACGAGGAGGCCTTCACCGACATTA
:::.:::: ::.::::: ::: :::::::.::::::::: :::::::..:::::::: .:.::::::::::::: ::::::::::::::::: :::::.:
GACCTGCGCAGGAAGACGGAGGTCCACGAGGTGGAGGAGCGGAAGAACAGCCAGATCAGCGCGCTGATGCAGCGGCACGAGGAGGCCTTCACGGACATCA
-D--L--R--R--K--T--E--V--H--E--V--E--E--R--K--N--S--Q--I--S--A--L--M--Q--R--H--E--E--A--F--T--D--I--

-------------------------------------------------------><-------------------------------------------
K--N--Y--Y--N--D--I--T--L--N--N--L--A--L--I--N--S--L--K--E--Q--M--E--D--M--R--K--K--E--D--H--L--E--R
AGAACTACTACAACGACATCACCCTCAACAACCTGGCCCTCATCAACTCCCTCAAGGAGCAGATGGAGGACATGCGGAAGAAGGAGGACCACCTGGAGAG
:::::::::::::::::.::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::.::. ::   ::::::::.
AGAACTACTACAACGACGTCACCCTCAACAACCTGGCGCTCATCAACTCCCTCAAGGAGCAGATGGAGGACATGCGGAAGAGGGGCGAGGTCCTGGAGAA
K--N--Y--Y--N--D--V--T--L--N--N--L--A--L--I--N--S--L--K--E--Q--M--E--D--M--R--K--R--G--E--V--L--E--K

----------------------------------------------------------------------------------------------------
--E--M--A--E--V--S--G--Q--N--K--R--L--A--D--P--L--Q--K--A--R--E--E--M--S--E--M--Q--K--Q--L--A--N--Y-
GGAGATGGCAGAGGTGTCTGGGCAGAACAAGCGCCTGGCAGACCCTCTCCAGAAGGCTCGGGAGGAGATGAGCGAGATGCAGAAACAGCTCGCAAACTAC
:::::::::.::::::::.. ::::::: .::::::::..::::: :: :::::::: ::.:: ::::::::::: ::::. ::. :::::.  ..::::
GGAGATGGCGGAGGTGTCCATGCAGAACCGGCGCCTGGTGGACCCGCTGCAGAAGGCGCGAGACGAGATGAGCGACATGCGCAAGAAGCTCAGCGGCTAC
--E--M--A--E--V--S--M--Q--N--R--R--L--V--D--P--L--Q--K--A--R--D--E--M--S--D--M--R--K--K--L--S--G--Y-

-----------------------><---------------------------------------------------------------------------
-E--R--D--K--Q--I--L--L--C--T--K--A--R--L--K--V--R--E--K--E--L--K--D--L--Q--W--E--H--E--V--L--E--Q--
GAGAGGGACAAGCAGATCCTGCTTTGCACAAAAGCCCGTTTGAAAGTCAGGGAGAAAGAGCTGAAAGACCTGCAGTGGGAGCATGAAGTGTTAGAGCAGC
:::::::::::::: ::::::                                                                               
GAGAGGGACAAGCACATCCTG-------------------------------------------------------------------------------
-E--R--D--K--H--I--L--------------------------------------------------------------------------------

----------><----------------------------------------------------------------------------------------
R--F--T--K--V--Q--Q--E--R--D--E--L--Y--R--K--F--T--A--A--I--Q--E--V--Q--Q--K--T--G--F--K--N--L--V--L
GATTCACCAAGGTGCAGCAGGAGCGGGACGAGCTCTATCGGAAGTTCACCGCAGCCATCCAGGAGGTGCAGCAGAAGACAGGGTTCAAGAACCTCGTGCT
           :::::::::::::::::.::::: ::.:::::::::::::: ::::::: ::::::::::::::::::::: :::::.:::::.:: .:
-----------GTGCAGCAGGAGCGGGATGAGCTGTACCGGAAGTTCACCGCCGCCATCCTGGAGGTGCAGCAGAAGACAGGCTTCAAAAACCTTGTCTT
------------V--Q--Q--E--R--D--E--L--Y--R--K--F--T--A--A--I--L--E--V--Q--Q--K--T--G--F--K--N--L--V--L

----------------------------------------------------------------------------------------------------
--E--R--K--L--Q--A--L--S--A--A--V--E--K--K--E--V--Q--F--N--E--V--L--A--A--S--N--L--D--P--A--A--L--T-
AGAACGCAAGCTGCAGGCTCTGAGCGCCGCTGTGGAGAAGAAGGAGGTGCAGTTCAACGAGGTCCTGGCTGCCTCTAACCTGGACCCTGCAGCCCTGACG
.::.:::::: ::::::: :::::.::.::.:::::: ::::::::::::::::::..::::: ::::: :::::.:::::::::::. :.::.::::: 
GGAGCGCAAGGTGCAGGCGCTGAGTGCTGCCGTGGAGCAGAAGGAGGTGCAGTTCAGTGAGGTGCTGGCAGCCTCCAACCTGGACCCCTCGGCTCTGACC
--E--R--K--V--Q--A--L--S--A--A--V--E--Q--K--E--V--Q--F--S--E--V--L--A--A--S--N--L--D--P--S--A--L--T-

--------------------><----------------------------------------------------------------><------------
-L--V--S--R--K--L--E--D--V--L--E--S--K--N--S--T--I--K--D--L--Q--Y--E--L--A--Q--V--C--K--A--H--N--D--
CTGGTGTCCCGCAAGCTGGAGGATGTTCTTGAGTCGAAGAACAGCACCATCAAGGACCTGCAGTATGAGCTGGCCCAGGTCTGTAAGGCCCATAACGACC
:: ::::::::::::::::::::.::.:: ::: ::::::::::::::::: :::::.:.:::::.:::::::: :. :::::.::::::::.:::::::
CTCGTGTCCCGCAAGCTGGAGGACGTCCTGGAGGCGAAGAACAGCACCATCCAGGACTTACAGTACGAGCTGGCGCGCGTCTGCAAGGCCCACAACGACC
-L--V--S--R--K--L--E--D--V--L--E--A--K--N--S--T--I--Q--D--L--Q--Y--E--L--A--R--V--C--K--A--H--N--D--

----------------------------------------------------------------------------------------------------
L--L--R--T--Y--E--A--K--L--L--A--F--G--I--P--L--D--N--V--G--F--K--P--L--E--T--A--V--I--G--Q--T--L--G
TGCTGCGCACGTATGAGGCAAAGCTGCTGGCCTTCGGGATCCCTCTGGACAACGTGGGCTTCAAGCCCTTGGAAACAGCTGTGATCGGACAGACACTGGG
:::::::.:: ::.:::::.::::::::::::::::::.::::.::::::::.:::::::::::::::.::::.::.:: :::.:.::::::::.:::::
TGCTGCGTACCTACGAGGCGAAGCTGCTGGCCTTCGGGGTCCCCCTGGACAATGTGGGCTTCAAGCCCCTGGAGACGGCGGTGGTTGGACAGACGCTGGG
L--L--R--T--Y--E--A--K--L--L--A--F--G--V--P--L--D--N--V--G--F--K--P--L--E--T--A--V--V--G--Q--T--L--G

------------------------------------>
--Q--G--P--A--G--L--V--G--T--P--T--*-
CCAGGGCCCCGCGGGACTGGTGGGCACCCCGACGTAG
:::.:::::::::::::::::::::::.:::::::::
CCAAGGCCCCGCGGGACTGGTGGGCACTCCGACGTAG
--Q--G--P--A--G--L--V--G--T--P--T--*-

Pig Consensus Sequence

>BGISUST0000890581
---GCGCCCAAACGGAAAGGGAAGAAAGGGAAGGCCAGAGGCACCCCGACTGTTGACGGGCTTGCTCCGGAGGACATGAGCAAGGAGCAG----------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------ATCGAGGCCAAGTACGACAAGAAGATGAAGATGCTTCGGGACGAGCTT
GACCTGCGCAGGAAGACGGAGGTCCACGAGGTGGAGGAGCGGAAGAACAGCCAGATCAGCGCGCTGATGCAGCGGCACGAGGAGGCCTTCACGGACATCA
AGAACTACTACAACGACGTCACCCTCAACAACCTGGCGCTCATCAACTCCCTCAAGGAGCAGATGGAGGACATGCGGAAGAGGGGCGAGGTCCTGGAGAA
GGAGATGGCGGAGGTGTCCATGCAGAACCGGCGCCTGGTGGACCCGCTGCAGAAGGCGCGAGACGAGATGAGCGACATGCGCAAGAAGCTCAGCGGCTAC
GAGAGGGACAAGCACATCCTG-------------------------------------------------------------------------------
-----------GTGCAGCAGGAGCGGGATGAGCTGTACCGGAAGTTCACCGCCGCCATCCTGGAGGTGCAGCAGAAGACAGGCTTCAAAAACCTTGTCTT
GGAGCGCAAGGTGCAGGCGCTGAGTGCTGCCGTGGAGCAGAAGGAGGTGCAGTTCAGTGAGGTGCTGGCAGCCTCCAACCTGGACCCCTCGGCTCTGACC
CTCGTGTCCCGCAAGCTGGAGGACGTCCTGGAGGCGAAGAACAGCACCATCCAGGACTTACAGTACGAGCTGGCGCGCGTCTGCAAGGCCCACAACGACC
TGCTGCGTACCTACGAGGCGAAGCTGCTGGCCTTCGGGGTCCCCCTGGACAATGTGGGCTTCAAGCCCCTGGAGACGGCGGTGGTTGGACAGACGCTGGG
CCAAGGCCCCGCGGGACTGGTGGGCACTCCGACGTAG


>BGISUSP0000890581
-APKRKGKKGKARGTPTVDGLAPEDMSKEQ----------------------------------------------------------------------
------------------------------------------------------------------------------------IEAKYDKKMKMLRDEL
DLRRKTEVHEVEERKNSQISALMQRHEEAFTDIKNYYNDVTLNNLALINSLKEQMEDMRKRGEVLEKEMAEVSMQNRRLVDPLQKARDEMSDMRKKLSGY
ERDKHIL------------------------------VQQERDELYRKFTAAILEVQQKTGFKNLVLERKVQALSAAVEQKEVQFSEVLAASNLDPSALT
LVSRKLEDVLEAKNSTIQDLQYELARVCKAHNDLLRTYEAKLLAFGVPLDNVGFKPLETAVVGQTLGQGPAGLVGTPT*