Sequences
EST Library Info
cst1Stomach - RNA from China
eje1Foetus 50 days, jejunum
nje2Newborn 115 days, jejunum
plac8Unavailable
relu2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000141448 (click for geneview)
Transcript ID ENST00000269216(link to ensembl)
Symbol GATA6
Localtion Chromosome:18:18003414:18036225:1 band: 18q11.2
Description Transcription factor GATA-6 (GATA binding factor-6). [Source:Uniprot/SWISSPROT;Acc:Q92908]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--L--T--D--G--G--W--C--L--P--K--R--F--G--A--A--G--A--D--A--S--D--S--R--A--F--P--A--R--E--P--S--
ATGGCCTTGACTGACGGCGGCTGGTGCTTGCCGAAGCGCTTCGGGGCCGCGGGTGCGGACGCCAGCGACTCCAGAGCCTTTCCAGCGCGGGAGCCCTCCA
::::::::::::::::::::::::::..::::.:::::::: :::::::::: ::::::::::.::::::::.::: :::::::::::::::::::::.:
ATGGCCTTGACTGACGGCGGCTGGTGTCTGCCAAAGCGCTTAGGGGCCGCGGCTGCGGACGCCGGCGACTCCGGAGGCTTTCCAGCGCGGGAGCCCTCTA
-M--A--L--T--D--G--G--W--C--L--P--K--R--L--G--A--A--A--A--D--A--G--D--S--G--G--F--P--A--R--E--P--S--

----------------------------------------------------------------------------------------------------
T--P--P--S--P--I--S--S--S--S--S--S--C--S--R--G--G--E--R--G--P--G--G--A--S--N--C--G--T--P--Q--L--D--T
CGCCGCCTTCCCCCATCTCTTCCTCGTCCTCCTCCTGCTCCCGGGGCGGAGAGCGGGGCCCCGGCGGCGCCAGCAACTGCGGGACGCCTCAGCTCGACAC
:::::::::::::::::::.::::: ::::::: :::::: :::::.::.::::: ::::::::::::::::::::::::.::::::: :::::::::::
CGCCGCCTTCCCCCATCTCCTCCTCTTCCTCCTGCTGCTCACGGGGTGGGGAGCGTGGCCCCGGCGGCGCCAGCAACTGCAGGACGCCGCAGCTCGACAC
T--P--P--S--P--I--S--S--S--S--S--C--C--S--R--G--G--E--R--G--P--G--G--A--S--N--C--R--T--P--Q--L--D--T

----------------------------------------------------------------------------------------------------
--E--A--A--A--G--P--P--A--R--S--L--L--L--S--S--Y--A--S--H--P--F--G--A--P--H--G--P--S--A--P--G--V--A-
GGAGGCGGCGGCCGGACCCCCGGCCCGCTCGCTGCTGCTCAGTTCCTACGCTTCGCATCCCTTCGGGGCTCCCCACGGACCTTCGGCGCCTGGGGTCGCG
:::::::::::: :::::: :.:::::::::::::::::::...:.:::::.::::::::::::::::::::.:::::::::::::::::.:::.:: : 
GGAGGCGGCGGCGGGACCCACAGCCCGCTCGCTGCTGCTCAACCCTTACGCCTCGCATCCCTTCGGGGCTCCTCACGGACCTTCGGCGCCCGGGATCTCT
--E--A--A--A--G--P--T--A--R--S--L--L--L--N--P--Y--A--S--H--P--F--G--A--P--H--G--P--S--A--P--G--I--S-

----------------------------------------------------------------------------------------------------
-G--P--G--G--N--L--S--S--W--E--D--L--L--L--F--T--D--L--D--Q--A--A--T--A--S--K--L--L--W--S--S--R--G--
GGCCCCGGGGGCAACCTGTCGAGCTGGGAGGACTTGCTGCTGTTCACTGACCTCGACCAAGCCGCGACCGCCAGCAAGCTGCTGTGGTCCAGCCGCGGCG
: ::::::::::. :::::::::::::::::::.:..:::: :::::::::::::::::.::::::::::::::::::::::::::::::::::::::::
GCCCCCGGGGGCGCCCTGTCGAGCTGGGAGGACCTATTGCTCTTCACTGACCTCGACCAGGCCGCGACCGCCAGCAAGCTGCTGTGGTCCAGCCGCGGCG
-A--P--G--G--A--L--S--S--W--E--D--L--L--L--F--T--D--L--D--Q--A--A--T--A--S--K--L--L--W--S--S--R--G--

----------------------------------------------------------------------------------------------------
A--K--L--S--P--F--A--P--E--Q--P--E--E--M--Y--Q--T--L--A--A--L--S--S--Q--G--P--A--A--Y--D--G--A--P--G
CCAAGCTGAGCCCCTTCGCACCCGAGCAGCCGGAGGAGATGTACCAGACCCTCGCCGCTCTCTCCAGCCAGGGTCCGGCCGCCTACGACGGCGCGCCCGG
:::::::::::::.::::::::::::::::::::::::::::::::::::::::: ::.:::::::::::::: :: :::::.:::::::: ::::::::
CCAAGCTGAGCCCTTTCGCACCCGAGCAGCCGGAGGAGATGTACCAGACCCTCGCAGCCCTCTCCAGCCAGGGGCCCGCCGCTTACGACGGAGCGCCCGG
A--K--L--S--P--F--A--P--E--Q--P--E--E--M--Y--Q--T--L--A--A--L--S--S--Q--G--P--A--A--Y--D--G--A--P--G

----------------------------------------------------------------------------------------------------
--G--F--V--H--S--A--A--A--A--A--A--A--A--A--A--A--S--S--P--V--Y--V--P--T--T--R--V--G--S--M--L--P--G-
CGGCTTCGTGCACTCTGCGGCCGCGGCGGCAGCAGCCGCGGCGGCGGCCAGCTCCCCGGTCTACGTGCCCACCACCCGCGTGGGTTCCATGCTGCCCGGC
::::::::::::::: ::::::::::: :::::.:::::.::::::::.:::::::::::.::::: :::::::: ::::::::.::::::::::: :::
CGGCTTCGTGCACTCGGCGGCCGCGGCTGCAGCGGCCGCAGCGGCGGCTAGCTCCCCGGTTTACGTTCCCACCACGCGCGTGGGCTCCATGCTGCCAGGC
--G--F--V--H--S--A--A--A--A--A--A--A--A--A--A--A--S--S--P--V--Y--V--P--T--T--R--V--G--S--M--L--P--G-

----------------------------------------------------------------------------------------------------
-L--P--Y--H--L--Q--G--S--G--S--G--P--A--N--H--A--G--G--A--G--A--H--P--G--W--P--Q--A--S--A--D--S--P--
CTACCGTACCACCTGCAGGGGTCGGGCAGTGGGCCAGCCAACCACGCGGGCGGCGCGGGCGCGCACCCCGGCTGGCCTCAGGCCTCGGCCGACAGCCCTC
:::::::::   ::::::::: :::::::.::::: :::::.::.::::::::::::::: :::::::::::::::: ::::::::.:: ::.:::::.:
CTACCGTAC---CTGCAGGGGGCGGGCAGCGGGCCCGCCAATCATGCGGGCGGCGCGGGCTCGCACCCCGGCTGGCCACAGGCCTCAGCGGATAGCCCCC
-L--P--Y-----L--Q--G--A--G--S--G--P--A--N--H--A--G--G--A--G--S--H--P--G--W--P--Q--A--S--A--D--S--P--

----------------------------------------------------------------------------------------------------
P--Y--G--S--G--G--G--A--A--G--G--G--A--A--G--P--G--G--A--G--S--A--A--A--H--V--S--A--R--F--P--Y--S--P
CATACGGCAGCGGAGGCGGCGCGGCTGGCGGCGGGGCCGCGGGGCCTGGCGGCGCTGGCTCAGCCGCGGCGCACGTCTCGGCGCGCTTCCCCTACTCTCC
::::.:::::::::::::::.:::: ::::::::::: :::::::: :::.:::: :::::.:::::::::::.:::::::::::::::::.::::: ::
CATATGGCAGCGGAGGCGGCACGGCGGGCGGCGGGGCGGCGGGGCCGGGCAGCGCAGGCTCGGCCGCGGCGCATGTCTCGGCGCGCTTCCCTTACTCGCC
P--Y--G--S--G--G--G--T--A--G--G--G--A--A--G--P--G--S--A--G--S--A--A--A--H--V--S--A--R--F--P--Y--S--P

----------------------------------------------------------------------------------------------------
--S--P--P--M--A--N--G--A--A--R--E--P--G--G--Y--A--A--A--G--S--G--G--A--G--G--V--S--G--G-----G--S--S-
CAGCCCGCCCATGGCCAACGGCGCCGCGCGGGAGCCGGGAGGCTACGCGGCGGCGGGCAGTGGGGGCGCGGGAGGCGTGAGCGGCGGC---GGCAGTAGC
:::::: :::::::::::.::::: ::  :::: :: ::.::::::::.:: :: :::.:.::::::::::: :::::::::::::::   :::.::.::
CAGCCCTCCCATGGCCAATGGCGCGGCTAGGGACCCCGGGGGCTACGCAGCTGCCGGCGGCGGGGGCGCGGGCGGCGTGAGCGGCGGCAGTGGCGGTGGC
--S--P--P--M--A--N--G--A--A--R--D--P--G--G--Y--A--A--A--G--G--G--G--A--G--G--V--S--G--G--S--G--G--G-

----------------------------------------------------------------------------------------------------
-L--A--A--M--G--G--R--E--P--Q--Y--S--S--L--S--A--A--R--P--L--N--G--T--Y--H--H--H--H--H--H--H--H--H--
CTGGCGGCCATGGGCGGCCGCGAGCCCCAGTACAGCTCGCTGTCGGCCGCGCGGCCGCTGAACGGGACGTACCACCACCACCACCACCACCACCACCACC
:::::::::::::::.::::::::: :::.:::::::::::.:::::::::::::::.::::::::::::::         ::.:::::.:::::.::::
CTGGCGGCCATGGGCAGCCGCGAGCACCAATACAGCTCGCTATCGGCCGCGCGGCCGTTGAACGGGACGTAC---------CATCACCATCACCATCACC
-L--A--A--M--G--S--R--E--H--Q--Y--S--S--L--S--A--A--R--P--L--N--G--T--Y-----------H--H--H--H--H--H--

----------------------------------------------------------------------------------------------------
H--P--S--P--Y--S--P--Y--V--G--A--P--L--T--P--A--W--P--A--G--P--F--E--T--P--V--L--H--S--L--Q--S--R--A
ATCCGAGCCCCTACTCGCCCTACGTGGGGGCGCCACTGACGCCTGCCTGGCCCGCCGGACCCTTCGAGACCCCGGTGCTGCACAGCCTGCAGAGCCGCGC
:.::.::. ::::::::::::::::::: :::::.::::::::.:: :::::.:: :::::::::::::::::::::::::::::.::.:::::.:::::
ACCCAAGTGCCTACTCGCCCTACGTGGGTGCGCCGCTGACGCCCGCATGGCCTGCGGGACCCTTCGAGACCCCGGTGCTGCACAGTCTACAGAGTCGCGC
H--P--S--A--Y--S--P--Y--V--G--A--P--L--T--P--A--W--P--A--G--P--F--E--T--P--V--L--H--S--L--Q--S--R--A

-------------------------------------><-------------------------------------------------------------
--G--A--P--L--P--V--P--R--G--P--S--A--D--L--L--E--D--L--S--E--S--R--E--C--V--N--C--G--S--I--Q--T--P-
CGGAGCCCCGCTCCCGGTGCCCCGGGGTCCCAGTGCAGACCTGCTGGAGGACCTGTCCGAGAGCCGCGAGTGCGTGAACTGCGGCTCCATCCAGACGCCG
::::::::::::::: :::::.:::::.:::::.:::   :::::::::::::::.: ::::::::::::::::::::::::::::::::.:::::::::
CGGAGCCCCGCTCCCTGTGCCTCGGGGCCCCAGCGCA---CTGCTGGAGGACCTGCCAGAGAGCCGCGAGTGCGTGAACTGCGGCTCCATTCAGACGCCG
--G--A--P--L--P--V--P--R--G--P--S--A-----L--L--E--D--L--P--E--S--R--E--C--V--N--C--G--S--I--Q--T--P-

----------------------------------------------------------------------------------------------------
-L--W--R--R--D--G--T--G--H--Y--L--C--N--A--C--G--L--Y--S--K--M--N--G--L--S--R--P--L--I--K--P--Q--K--
CTGTGGCGGCGGGACGGCACCGGCCACTACCTGTGCAACGCCTGCGGGCTCTACAGCAAGATGAACGGCCTCAGCCGGCCCCTCATCAAGCCGCAGAAGC
::.:::::::::::::::::::::::::::.::::::::::::::                                                       
CTATGGCGGCGGGACGGCACCGGCCACTACTTGTGCAACGCCTGC-------------------------------------------------------
-L--W--R--R--D--G--T--G--H--Y--L--C--N--A--C--------------------------------------------------------

----><----------------------------------------------------------------------------------------------
R--V--P--S--S--R--R--L--G--L--S--C--A--N--C--H--T--T--T--T--T--L--W--R--R--N--A--E--G--E--P--V--C--N
GCGTGCCTTCATCACGGCGGCTTGGATTGTCCTGTGCCAACTGTCACACCACAACTACCACCTTATGGCGCAGAAACGCCGAGGGTGAACCCGTGTGCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------><--------------------------------------------------------------------
--A--C--G--L--Y--M--K--L--H--G--V--P--R--P--L--A--M--K--K--E--G--I--Q--T--R--K--R--K--P--K--N--I--N-
TGCTTGTGGACTCTACATGAAACTCCATGGGGTGCCCAGACCACTTGCTATGAAAAAAGAGGGAATTCAAACCAGGAAACGAAAACCTAAGAACATAAAT
                               :::::. ::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::
-------------------------------GTGCCTCGACCGCTTGCTATGAAAAAAGAGGGAATTCAAACCAGGAAACGAAAACCTAAGAACATAAAT
--------------------------------V--P--R--P--L--A--M--K--K--E--G--I--Q--T--R--K--R--K--P--K--N--I--N-

------------------><--------------------------------------------------------------------------------
-K--S--K--T--C--S--G--N--S--N--N--S--I--P--M--T--P--T--S--T--S--S--N--S--D--D--C--S--K--N--T--S--P--
AAATCAAAGACTTGCTCTGGTAATAGCAATAATTCCATTCCCATGACTCCAACTTCCACCTCTTCTAACTCAGATGATTGCAGCAAAAATACTTCCCCCA
::.:::::..::::::::   ::::::::::::::..:.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:
AAGTCAAAAGCTTGCTCT---AATAGCAATAATTCTGTCCCCATGACTCCAACTTCCACCTCTTCTAACTCAGATGATTGCAGCAAAAATACTTCCCCTA
-K--S--K--A--C--S-----N--S--N--N--S--V--P--M--T--P--T--S--T--S--S--N--S--D--D--C--S--K--N--T--S--P--

----------------------><----------------------------------------------------------------------------
T--T--Q--P--T--A--S--G--A--G--A--P--V--M--T--G--A--G--E--S--T--N--P--E--N--S--E--L--K--Y--S--G--Q--D
CAACACAACCTACAGCCTCAGGGGCGGGTGCCCCGGTGATGACTGGTGCGGGAGAGAGCACCAATCCCGAGAACAGCGAGCTCAAGTATTCGGGTCAAGA
:::::::: :  ::::.:: :::::.::.:::.:::::::: ::::..::::.::::::.:.:::::::::::::::::::::::.::.::.::::::::
CAACACAAACGCCAGCTTCTGGGGCAGGCGCCTCGGTGATGTCTGGCACGGGGGAGAGCGCTAATCCCGAGAACAGCGAGCTCAAATACTCAGGTCAAGA
T--T--Q--T--P--A--S--G--A--G--A--S--V--M--S--G--T--G--E--S--A--N--P--E--N--S--E--L--K--Y--S--G--Q--D

------------------------------------------------------------------------------------------>
--G--L--Y--I--G--V--S--L--A--S--P--A--E--V--T--S--S--V--R--P--D--S--W--C--A--L--A--L--A--*-
TGGGCTCTACATAGGCGTCAGTCTCGCCTCGCCGGCCGAAGTCACGTCCTCCGTGCGACCGGATTCCTGGTGCGCCCTGGCCCTGGCCTGA
.::::: ::::::::.:::::.:: :::::::::::.:::::::: ::::: ::: ::: :::::::::::::::::::::::::::::::
CGGGCTGTACATAGGTGTCAGCCTGGCCTCGCCGGCTGAAGTCACCTCCTCGGTGAGACAGGATTCCTGGTGCGCCCTGGCCCTGGCCTGA
--G--L--Y--I--G--V--S--L--A--S--P--A--E--V--T--S--S--V--R--Q--D--S--W--C--A--L--A--L--A--*-

Pig Consensus Sequence

>BGISUST0000896550
ATGGCCTTGACTGACGGCGGCTGGTGTCTGCCAAAGCGCTTAGGGGCCGCGGCTGCGGACGCCGGCGACTCCGGAGGCTTTCCAGCGCGGGAGCCCTCTA
CGCCGCCTTCCCCCATCTCCTCCTCTTCCTCCTGCTGCTCACGGGGTGGGGAGCGTGGCCCCGGCGGCGCCAGCAACTGCAGGACGCCGCAGCTCGACAC
GGAGGCGGCGGCGGGACCCACAGCCCGCTCGCTGCTGCTCAACCCTTACGCCTCGCATCCCTTCGGGGCTCCTCACGGACCTTCGGCGCCCGGGATCTCT
GCCCCCGGGGGCGCCCTGTCGAGCTGGGAGGACCTATTGCTCTTCACTGACCTCGACCAGGCCGCGACCGCCAGCAAGCTGCTGTGGTCCAGCCGCGGCG
CCAAGCTGAGCCCTTTCGCACCCGAGCAGCCGGAGGAGATGTACCAGACCCTCGCAGCCCTCTCCAGCCAGGGGCCCGCCGCTTACGACGGAGCGCCCGG
CGGCTTCGTGCACTCGGCGGCCGCGGCTGCAGCGGCCGCAGCGGCGGCTAGCTCCCCGGTTTACGTTCCCACCACGCGCGTGGGCTCCATGCTGCCAGGC
CTACCGTACCTGCAGGGGGCGGGCAGCGGGCCCGCCAATCATGCGGGCGGCGCGGGCTCGCACCCCGGCTGGCCACAGGCCTCAGCGGATAGCCCCCCAT
ATGGCAGCGGAGGCGGCACGGCGGGCGGCGGGGCGGCGGGGCCGGGCAGCGCAGGCTCGGCCGCGGCGCATGTCTCGGCGCGCTTCCCTTACTCGCCCAG
CCCTCCCATGGCCAATGGCGCGGCTAGGGACCCCGGGGGCTACGCAGCTGCCGGCGGCGGGGGCGCGGGCGGCGTGAGCGGCGGCAGTGGCGGTGGCCTG
GCGGCCATGGGCAGCCGCGAGCACCAATACAGCTCGCTATCGGCCGCGCGGCCGTTGAACGGGACGTACCATCACCATCACCATCACCACCCAAGTGCCT
ACTCGCCCTACGTGGGTGCGCCGCTGACGCCCGCATGGCCTGCGGGACCCTTCGAGACCCCGGTGCTGCACAGTCTACAGAGTCGCGCCGGAGCCCCGCT
CCCTGTGCCTCGGGGCCCCAGC---CTGCTGGAGGACCTGCCAGAGAGCCGCGAGTGCGTGAACTGCGGCTCCATTCAGACGCCGCTATGGCGGCGGGAC
GGCACCGGCCACTACTTGTGCAACGCCTGC----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------GTGCCTCGACCGCTTGCTATGAAAAAAGAGGGAATTCAAACCAGGAAACGAAAACCTAAGAACATAAATAAGTCAAAAGCTTGC
TCT---AATAGCAATAATTCTGTCCCCATGACTCCAACTTCCACCTCTTCTAACTCAGATGATTGCAGCAAAAATACTTCCCCTACAACACAAACGCCAG
CTTCTGGGGCAGGCGCCTCGGTGATGTCTGGCACGGGGGAGAGCGCTAATCCCGAGAACAGCGAGCTCAAATACTCAGGTCAAGACGGGCTGTACATAGG
TGTCAGCCTGGCCTCGCCGGCTGAAGTCACCTCCTCGGTGAGACAGGATTCCTGGTGCGCCCTGGCCCTGGCCTGA


>BGISUSP0000896550
MALTDGGWCLPKRLGAAAADAGDSGGFPAREPSTPPSPISSSSSCCSRGGERGPGGASNCRTPQLDTEAAAGPTARSLLLNPYASHPFGAPHGPSAPGIS
APGGALSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPG
LPYLQGAGSGPANHAGGAGSHPGWPQASADSPPYGSGGGTAGGGAAGPGSAGSAAAHVSARFPYSPSPPMANGAARDPGGYAAAGGGGAGGVSGGSGGGL
AAMGSREHQYSSLSAARPLNGTYHHHHHHHPSAYSPYVGAPLTPAWPAGPFETPVLHSLQSRAGAPLPVPRGPS-LLEDLPESRECVNCGSIQTPLWRRD
GTGHYLCNAC--------------------------------------------------------------VPRPLAMKKEGIQTRKRKPKNINKSKAC
S-NSNNSVPMTPTSTSSNSDDCSKNTSPTTQTPASGAGASVMSGTGESANPENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALALA*