Sequences
EST Library Info
cli2Liver - RNA from China
Clusters
Oligos
SNPs

Gene ID ENSG00000141505 (click for geneview)
Transcript ID ENST00000269299(link to ensembl)
Symbol ASGR1
Localtion Chromosome:17:7017474:7023386:-1 band: 17p13.1
Description Asialoglycoprotein receptor 1 (Hepatic lectin H1) (ASGPR) (ASGP-R). [Source:Uniprot/SWISSPROT;Acc:P07306]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------><-----------------------------
-M--T--K--E--Y--Q--D--L--Q--H--L--D--N--E--E--S--D--H--H--Q--L--R--K--G--P--P--P--P--Q--P--L--L--Q--
ATGACCAAGGAGTATCAAGACCTTCAGCATCTGGACAATGAGGAGAGTGACCACCATCAGCTCAGAAAAGGGCCACCTCCTCCCCAGCCCCTCCTGCAGC
::::: :::::.:::::.::.:: ::::::::::::::::::::::.:::::: ::                ::::::::::  : :.: ::::: :.::
ATGACGAAGGAATATCAGGATCTGCAGCATCTGGACAATGAGGAGAATGACCAGCAG---------------CCACCTCCTCAACCGTCACTCCTTCGGC
-M--T--K--E--Y--Q--D--L--Q--H--L--D--N--E--E--N--D--Q--Q-----------------P--P--P--Q--P--S--L--L--R--

--------------------------------------------------------------------------------------><------------
R--L--C--S--G--P--R--L--L--L--L--S--L--G--L--S--L--L--L--L--V--V--V--C--V--I--G--S--Q--N--S--Q--L--Q
GTCTCTGCTCCGGACCTCGCCTCCTCCTGCTCTCCCTGGGCCTCAGCCTCCTGCTGCTTGTGGTTGTCTGTGTGATCGGATCCCAAAACTCCCAGCTGCA
:::::::::: :::::..::::::::.:: :.::: :::::::.:::::::::::::: ::.:::::::::::::::::::::      ::: :::::::
GTCTCTGCTCGGGACCCTGCCTCCTCTTGATTTCCATGGGCCTTAGCCTCCTGCTGCTGGTAGTTGTCTGTGTGATCGGATCC------TCCAAGCTGCA
R--L--C--S--G--P--C--L--L--L--I--S--M--G--L--S--L--L--L--L--V--V--V--C--V--I--G--S--------S--K--L--Q

----------------------------------------------------------------------------------><----------------
--E--E--L--R--G--L--R--E--T--F--S--N--F--T--A--S--T--E--A--Q--V--K--G--L--S--T--Q--G--G--N--V--G--R-
GGAGGAGCTGCGGGGCCTGAGAGAGACGTTCAGCAACTTCACAGCGAGCACGGAGGCCCAGGTCAAGGGCTTGAGCACCCAGGGAGGCAATGTGGGAAGA
:::::::::::.:: :::::::::::: :::::::::.:::: ::::::::.:: ::: ::::::::. :.: ::::. :::   :: :::::::: :::
GGAGGAGCTGCAGGCCCTGAGAGAGACCTTCAGCAACCTCACCGCGAGCACAGACGCCAAGGTCAAGACCCTCAGCATGCAG---GGAAATGTGGGCAGA
--E--E--L--Q--A--L--R--E--T--F--S--N--L--T--A--S--T--D--A--K--V--K--T--L--S--M--Q-----G--N--V--G--R-

------------------------------------------------------><--------------------------------------------
-K--M--K--S--L--E--S--Q--L--E--K--Q--Q--K--D--L--S--E--D--H--S--S--L--L--L--H--V--K--Q--F--V--S--D--
AAGATGAAGTCGCTAGAGTCCCAGCTGGAGAAACAGCAGAAGGACCTGAGTGAAGATCACTCCAGCCTGCTGCTCCACGTGAAGCAGTTCGTGTCTGACC
::::::::::: ::.:::::::::::::::::::::::. ::::::::::::::   :::::::::.::::::::::::::::::::::.:::::.::::
AAGATGAAGTCCCTGGAGTCCCAGCTGGAGAAACAGCAACAGGACCTGAGTGAA---CACTCCAGCTTGCTGCTCCACGTGAAGCAGTTTGTGTCCGACC
-K--M--K--S--L--E--S--Q--L--E--K--Q--Q--Q--D--L--S--E-----H--S--S--L--L--L--H--V--K--Q--F--V--S--D--

-----------------------------------------><---------------------------------------------------------
L--R--S--L--S--C--Q--M--A--A--L--Q--G--N--G--S--E--R--T--C--C--P--V--N--W--V--E--H--E--R--S--C--Y--W
TGCGGAGCCTGAGCTGTCAGATGGCGGCGCTCCAGGGCAATGGCTCAGAAAGGACCTGCTGCCCGGTCAACTGGGTGGAGCACGAGCGCAGCTGCTACTG
:::::::::: :::::::::::::: :. ::::::::::::   :: ::::::::::::::::::::.::::::::::: .:.::. :::::::::::::
TGCGGAGCCTCAGCTGTCAGATGGCTGTCCTCCAGGGCAAT---TCTGAAAGGACCTGCTGCCCGGTTAACTGGGTGGACTATGAAGGCAGCTGCTACTG
L--R--S--L--S--C--Q--M--A--V--L--Q--G--N-----S--E--R--T--C--C--P--V--N--W--V--D--Y--E--G--S--C--Y--W

------------------------------------------------------------------------------------------------><--
-----F--S--R--S--G--K--A--W--A--D--A--D--N--Y--C--R--L--E--D--A--H--L--V--V--V--T--S--W--E--E--Q--K-
G---TTCTCTCGCTCCGGGAAGGCCTGGGCTGACGCCGACAACTACTGCCGGCTGGAGGACGCGCACCTGGTGGTGGTCACGTCCTGGGAGGAGCAGAAA
:   :::::.:::::.:::::: ::::: : :: ::::: :: :::::::.:::::::.:::: ::::: :::::::: .  ::::::::::::::::::
GG--TTCTCCCGCTCTGGGAAGCCCTGGCCGGAGGCCGAGAAGTACTGCCAGCTGGAGAACGCCCACCTCGTGGTGGTGGGCTCCTGGGAGGAGCAGAAA
--\--F--S--R--S--G--K--P--W--P--E--A--E--K--Y--C--Q--L--E--N--A--H--L--V--V--V--G--S--W--E--E--Q--K-

----------------------------------------------------------------------------------------------------
-F--V--Q--H--H--I--G--P--V--N--T--W--M--G--L--H--D--Q--N--G--P--W--K--W--V--D--G--T--D--Y--E--T--G--
TTTGTCCAGCACCACATAGGCCCTGTGAACACCTGGATGGGCCTCCACGACCAAAACGGGCCCTGGAAGTGGGTGGACGGGACGGACTACGAGACGGGCT
:::.:::::::::::.:.:::::::::::: ::::::: ::::::  .::.::.:.:::::::::::::::::::::.:: :: ::::::::: ::::.:
TTTATCCAGCACCACGTGGGCCCTGTGAACTCCTGGATCGGCCTCACTGATCAGAGCGGGCCCTGGAAGTGGGTGGATGGCACCGACTACGAGTCGGGTT
-F--I--Q--H--H--V--G--P--V--N--S--W--I--G--L--T--D--Q--S--G--P--W--K--W--V--D--G--T--D--Y--E--S--G--

---><-----------------------------------------------------------------------------------------------
F--K--N--W--R--P--E--Q--P--D--D--W--Y--G--H--G--L--G--G--G--E--D--C--A--H--F--T--D--D--G--R--W--N--D
TCAAGAACTGGAGGCCGGAGCAGCCGGACGACTGGTACGGCCACGGGCTCGGAGGAGGCGAGGACTGTGCCCACTTCACCGACGACGGCCGCTGGAACGA
::   ::::::::.:: :::::::::::.::::::::::: ::.::::::::.:: ::::::::::::::::::::.:: :: :::::: ::::::::::
TC---AACTGGAGACCCGAGCAGCCGGATGACTGGTACGGGCATGGGCTCGGGGGTGGCGAGGACTGTGCCCACTTTACGGAGGACGGCGGCTGGAACGA
F-----N--W--R--P--E--Q--P--D--D--W--Y--G--H--G--L--G--G--G--E--D--C--A--H--F--T--E--D--G--G--W--N--D

------------------------------------------------------------------------------------>
--D--V--C--Q--R--P--Y--R--W--V--C--E--T--E--L--D--K--------A--S--Q--E--P--P--L--L--*-
CGACGTCTGCCAGAGGCCCTACCGCTGGGTCTGCGAGACAGAGCTGGACAAG------GCCAGCCAGGAGCCACCTCTCCTTTAA
.::::::::::::::::::::::::::::::::::::::: ::: :::::.:      : ::::.:::::.: ::::::      
TGACGTCTGCCAGAGGCCCTACCGCTGGGTCTGCGAGACACAGCGGGACAGGGACAGCGGCAGCTAGGAGTCTCCTCTC------
--D--V--C--Q--R--P--Y--R--W--V--C--E--T--Q--R--D--R--D--S--G--S--*--E--S--P--L-------

Pig Consensus Sequence

>BGISUST0000890041
ATGACGAAGGAATATCAGGATCTGCAGCATCTGGACAATGAGGAGAATGACCAGCAG---------------CCACCTCCTCAACCGTCACTCCTTCGGC
GTCTCTGCTCGGGACCCTGCCTCCTCTTGATTTCCATGGGCCTTAGCCTCCTGCTGCTGGTAGTTGTCTGTGTGATCGGATCC------TCCAAGCTGCA
GGAGGAGCTGCAGGCCCTGAGAGAGACCTTCAGCAACCTCACCGCGAGCACAGACGCCAAGGTCAAGACCCTCAGCATGCAG---GGAAATGTGGGCAGA
AAGATGAAGTCCCTGGAGTCCCAGCTGGAGAAACAGCAACAGGACCTGAGTGAA---CACTCCAGCTTGCTGCTCCACGTGAAGCAGTTTGTGTCCGACC
TGCGGAGCCTCAGCTGTCAGATGGCTGTCCTCCAGGGCAAT---TCTGAAAGGACCTGCTGCCCGGTTAACTGGGTGGACTATGAAGGCAGCTGCTACTG
gtTCTCCCGCTCTGGGAAGCCCTGGCCGGAGGCCGAGAAGTACTGCCAGCTGGAGAACGCCCACCTCGTGGTGGTGGGCTCCTGGGAGGAGCAGAAATTT
ATCCAGCACCACGTGGGCCCTGTGAACTCCTGGATCGGCCTCACTGATCAGAGCGGGCCCTGGAAGTGGGTGGATGGCACCGACTACGAGTCGGGTTTC-
--AACTGGAGACCCGAGCAGCCGGATGACTGGTACGGGCATGGGCTCGGGGGTGGCGAGGACTGTGCCCACTTTACGGAGGACGGCGGCTGGAACGATGA
CGTCTGCCAGAGGCCCTACCGCTGGGTCTGCGAGACACAGCGGGACAGGGACAGCGGCAGCTAGGAGTCT------


>BGISUSP0000890041
MTKEYQDLQHLDNEENDQQ-----PPPQPSLLRRLCSGPCLLLISMGLSLLLLVVVCVIGS--SKLQEELQALRETFSNLTASTDAKVKTLSMQ-GNVGR
KMKSLESQLEKQQQDLSE-HSSLLLHVKQFVSDLRSLSCQMAVLQGN-SERTCCPVNWVDYEGSCYWFSRSGKPWPEAEKYCQLENAHLVVVGSWEEQKF
IQHHVGPVNSWIGLTDQSGPWKWVDGTDYESGF-NWRPEQPDDWYGHGLGGGEDCAHFTEDGGWNDDVCQRPYRWVCETQRDRDSGS*ES--