Sequences
EST Library Info
pigcb1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000142634 (click for geneview)
Transcript ID ENST00000270750(link to ensembl)
Symbol EFHD2
Localtion Chromosome:1:15481739:15502132:1 band: 1p36.21
Description EF-hand domain-containing protein 2 (Swiprosin-1). [Source:Uniprot/SWISSPROT;Acc:Q96C19]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--T--D--E--L--A--T--K--L--S--R--R--L--Q--M--E--G--E--G--G--G--E--T--P--E--Q--P--G--L--N--G--A--
ATGGCCACGGACGAGCTGGCCACCAAGCTGAGCCGGCGGCTGCAGATGGAGGGCGAGGGCGGCGGCGAGACCCCGGAGCAGCCCGGGCTGAACGGGGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--A--A--A--A--G--A--P--D--E--A--A--E--A--L--G--S--A--D--C--E--L--S--A--K--L--L--R--R--A--D--L--N--Q
CGGCGGCGGCGGCGGGGGCACCCGACGAGGCGGCCGAGGCGCTGGGCAGCGCGGACTGCGAGCTGAGCGCCAAGCTGCTGCGGCGCGCAGACCTCAACCA
                                                                    :::::::::::::::::::: :::::::::::
--------------------------------------------------------------------GCCAAGCTGCTGCGGCGCGCCGACCTCAACCA
---------------------------------------------------------------------A--K--L--L--R--R--A--D--L--N--Q

----------------------------------------------------------------------------------------------------
--G--I--G--E--P--Q--S--P--S--R--R--V--F--N--P--Y--T--E--F--K--E--F--S--R--K--Q--I--K--D--M--E--K--M-
GGGCATCGGCGAGCCCCAGTCGCCCAGCCGCCGCGTCTTCAACCCCTACACCGAGTTCAAGGAGTTCTCCAGGAAGCAGATCAAGGACATGGAGAAGATG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::
GGGCATCGGCGAGCCCCAGTCGCCCAGCCGCCGCGTCTTCAACCCCTACACCGAGTTCAAGGAGTTCTCCAGGAAGCAGATCAAGGACATGGAGAAAATG
--G--I--G--E--P--Q--S--P--S--R--R--V--F--N--P--Y--T--E--F--K--E--F--S--R--K--Q--I--K--D--M--E--K--M-

-------><-------------------------------------------------------------------------------------------
-F--K--Q--Y--D--A--G--R--D--G--F--I--D--L--M--E--L--K--L--M--M--E--K--L--G--A--P--Q--T--H--L--G--L--
TTCAAGCAGTATGATGCCGGGCGGGACGGCTTCATCGACCTGATGGAGCTAAAACTCATGATGGAGAAACTTGGGGCCCCTCAGACCCACCTGGGCCTGA
::::::   :::::.::::: :::::.::::::::::::::::::::::: ::.::::::::::::::::: ::.::.::::::::::::::::::::::
TTCAAG---TATGACGCCGGCCGGGATGGCTTCATCGACCTGATGGAGCTCAAGCTCATGATGGAGAAACTGGGAGCTCCTCAGACCCACCTGGGCCTGA
-F--K-----Y--D--A--G--R--D--G--F--I--D--L--M--E--L--K--L--M--M--E--K--L--G--A--P--Q--T--H--L--G--L--

-------------------------------------------------------><-------------------------------------------
K--N--M--I--K--E--V--D--E--D--F--D--S--K--L--S--F--R--E--F--L--L--I--F--R--K--A--A--A--G--E--L--Q--E
AAAACATGATCAAGGAGGTGGATGAGGACTTTGACAGCAAGCTGAGCTTCCGGGAGTTCCTCCTGATCTTCCGCAAGGCGGCGGCCGGGGAGCTTCAGGA
::::::::::::::::::::::.:::::::::::::::::::: :::::::::::::::::::::::.:::::::::::.::.::::::::::: :::::
AAAACATGATCAAGGAGGTGGACGAGGACTTTGACAGCAAGCTCAGCTTCCGGGAGTTCCTCCTGATTTTCCGCAAGGCAGCAGCCGGGGAGCTGCAGGA
K--N--M--I--K--E--V--D--E--D--F--D--S--K--L--S--F--R--E--F--L--L--I--F--R--K--A--A--A--G--E--L--Q--E

------------------------------------------------------------------------------------------><--------
--D--S--G--L--C--V--L--A--R--L--S--E--I--D--V--S--S--E--G--V--K--G--A--K--S--F--F--E--A--K--V--Q--A-
GGACAGCGGGCTGTGCGTGCTGGCCCGCCTCTCTGAGATCGACGTCTCCAGTGAGGGTGTCAAGGGGGCCAAGAGCTTCTTTGAGGCCAAGGTCCAGGCC
:::::::::::::..::::::::::::::::::.::::::::.:: :::: .::::::::::::::.:: ::::::::::::::::::::::::::::::
GGACAGCGGGCTGCACGTGCTGGCCCGCCTCTCCGAGATCGATGTGTCCACCGAGGGTGTCAAGGGAGCGAAGAGCTTCTTTGAGGCCAAGGTCCAGGCC
--D--S--G--L--H--V--L--A--R--L--S--E--I--D--V--S--T--E--G--V--K--G--A--K--S--F--F--E--A--K--V--Q--A-

----------------------------------------------------------------------------------------------------
-I--N--V--S--S--R--F--E--E--E--I--K--A--E--Q--E--E--R--K--K--Q--A--E--E--M--K--Q--R--K--A--A--F--K--
ATCAACGTGTCCAGCCGCTTCGAGGAGGAGATCAAGGCAGAGCAGGAGGAAAGGAAGAAGCAGGCGGAGGAGATGAAGCAGCGGAAAGCGGCCTTCAAGG
::::::::::::::::::::::::::::::::::::::::::::::::::.::::: :::::::::::::: ::::::::::::: ::::::::::::::
ATCAACGTGTCCAGCCGCTTCGAGGAGGAGATCAAGGCAGAGCAGGAGGAGAGGAACAAGCAGGCGGAGGACATGAAGCAGCGGATAGCGGCCTTCAAGG
-I--N--V--S--S--R--F--E--E--E--I--K--A--E--Q--E--E--R--N--K--Q--A--E--D--M--K--Q--R--I--A--A--F--K--

---------------------->
E--L--Q--S--T--F--K--*-
AGCTGCAGTCCACCTTTAAGTAG
::::::::::::::::.::::::
AGCTGCAGTCCACCTTCAAGTAG
E--L--Q--S--T--F--K--*-

Pig Consensus Sequence

>BGISUST0000895312
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------GCCAAGCTGCTGCGGCGCGCCGACCTCAACCA
GGGCATCGGCGAGCCCCAGTCGCCCAGCCGCCGCGTCTTCAACCCCTACACCGAGTTCAAGGAGTTCTCCAGGAAGCAGATCAAGGACATGGAGAAAATG
TTCAAG---TATGACGCCGGCCGGGATGGCTTCATCGACCTGATGGAGCTCAAGCTCATGATGGAGAAACTGGGAGCTCCTCAGACCCACCTGGGCCTGA
AAAACATGATCAAGGAGGTGGACGAGGACTTTGACAGCAAGCTCAGCTTCCGGGAGTTCCTCCTGATTTTCCGCAAGGCAGCAGCCGGGGAGCTGCAGGA
GGACAGCGGGCTGCACGTGCTGGCCCGCCTCTCCGAGATCGATGTGTCCACCGAGGGTGTCAAGGGAGCGAAGAGCTTCTTTGAGGCCAAGGTCCAGGCC
ATCAACGTGTCCAGCCGCTTCGAGGAGGAGATCAAGGCAGAGCAGGAGGAGAGGAACAAGCAGGCGGAGGACATGAAGCAGCGGATAGCGGCCTTCAAGG
AGCTGCAGTCCACCTTCAAGTAG


>BGISUSP0000895312
--------------------------------------------------------AKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKM
FK-YDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLHVLARLSEIDVSTEGVKGAKSFFEAKVQA
INVSSRFEEEIKAEQEERNKQAEDMKQRIAAFKELQSTFK*