Sequences
EST Library Info
aor2Aorta
che3Heart - RNA from China
cje2Jejunum - RNA from China
cki2Kidney - RNA from China
cmu2Rhinal mucous membrane - RNA from China
csk2Skin - RNA from China
csp9Spleen - RNA from China
cte2Testicle - RNA from China
cut3Uterus - RNA from China
dbla2Unavailable
eje1Foetus 50 days, jejunum
gul1Gullet
isp3M. Infraspinatus
jej4Small intestine, jejunum
nbm1Newborn 115 days, bone marrow (pelvis)
nco2Newborn 115 days, colon
nlu1Newborn 115 days, lung
nmm1Newborn 115 days, mucosal membranes
ova1Ovary
pliv1Unavailable
plun1Unavailable
rec1Rectum
ret1Retina
sag3Salivary gland
sin3Small intestine
sme3M. Semimembranosus
spl1Spleen
ssp2M. Supraspinatus
ste3M. Semitendinosus
tes3Testes
thg2Thyroid gland
uio2Unavailable
vin2M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000143106 (click for geneview)
Transcript ID ENST00000271308(link to ensembl)
Symbol PSMA5
Localtion Chromosome:1:109656520:109681079:-1 band: 1p13.3
Description Proteasome subunit alpha type 5 (EC 3.4.25.1) (Proteasome zeta chain) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain). [Source:Uniprot/SWISSPROT;Acc:P28066]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------><-----------------------------------------------------------------><---
-M--F--L--T--R--S--E--Y--D--R--G--V--N--T--F--S--P--E--G--R--L--F--Q--V--E--Y--A--I--E--A--I--K--L--
ATGTTTCTTACCCGGTCTGAGTACGACAGGGGCGTGAATACTTTTTCTCCCGAAGGAAGATTATTTCAAGTGGAATATGCCATTGAGGCTATCAAGCTTG
                                                                                                ::::
------------------------------------------------------------------------------------------------CTTG
-------------------------------------------------------------------------------------------------L--

----------------------------------------------------------------------------------------------------
G--S--T--A--I--G--I--Q--T--S--E--G--V--C--L--A--V--E--K--R--I--T--S--P--L--M--E--P--S--S--I--E--K--I
GTTCTACAGCCATTGGGATCCAGACATCAGAGGGTGTGTGCCTAGCTGTGGAGAAGAGAATTACTTCCCCACTGATGGAGCCCAGCAGCATTGAGAAAAT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::.:: :::::::::::::::::::::::.::
GTTCTACAGCCATTGGGATCCAGACATCAGAGGGTGTGTGCCTAGCTGTGGAGAAGAGAATTACCTCTCCGCTCATGGAGCCCAGCAGCATTGAGAAGAT
G--S--T--A--I--G--I--Q--T--S--E--G--V--C--L--A--V--E--K--R--I--T--S--P--L--M--E--P--S--S--I--E--K--I

----------------------><------------------------------------------------------------------><--------
--V--E--I--D--A--H--I--G--C--A--M--S--G--L--I--A--D--A--K--T--L--I--D--K--A--R--V--E--T--Q--N--H--W-
TGTAGAGATTGATGCTCACATAGGTTGTGCCATGAGTGGGCTAATTGCTGATGCTAAGACTTTAATTGATAAAGCCAGAGTGGAGACACAGAACCACTGG
::::::::::::::::::::::                                                                     :::::::::
TGTAGAGATTGATGCTCACATA---------------------------------------------------------------------AACCACTGG
--V--E--I--D--A--H--I-----------------------------------------------------------------------N--H--W-

--------------------------------------------------------------------------------------------------><
-F--T--Y--N--E--T--M--T--V--E--S--V--T--Q--A--V--S--N--L--A--L--Q--F--G--E--E--D--A--D--P--G--A--M--
TTCACCTACAATGAGACAATGACAGTGGAGAGTGTGACCCAAGCTGTGTCCAATCTGGCTTTGCAGTTTGGAGAAGAAGATGCAGATCCAGGTGCCATGT
::::::::::::::::::::::::::.:::::::::::.::.:::::::: :::::::::.: ::::::::::::::.::::::::::::::::::::::
TTCACCTACAATGAGACAATGACAGTAGAGAGTGTGACTCAGGCTGTGTCAAATCTGGCTCTCCAGTTTGGAGAAGAGGATGCAGATCCAGGTGCCATGT
-F--T--Y--N--E--T--M--T--V--E--S--V--T--Q--A--V--S--N--L--A--L--Q--F--G--E--E--D--A--D--P--G--A--M--

---------------------------------------------------------><-----------------------------------------
S--R--P--F--G--V--A--L--L--F--G--G--V--D--E--K--G--P--Q--L--F--H--M--D--P--S--G--T--F--V--Q--C--D--A
CTCGTCCCTTTGGAGTAGCATTATTATTTGGAGGAGTTGATGAGAAAGGACCCCAGCTGTTTCATATGGACCCATCTGGGACCTTTGTACAGTGTGATGC
::::::::::.:::::::::.:.::::::::::::::::::::.::::::::::::   :::::::::::.::::::::.:: :::::::::::::::::
CTCGTCCCTTCGGAGTAGCACTGTTATTTGGAGGAGTTGATGAAAAAGGACCCCAG---TTTCATATGGATCCATCTGGAACGTTTGTACAGTGTGATGC
S--R--P--F--G--V--A--L--L--F--G--G--V--D--E--K--G--P--Q-----F--H--M--D--P--S--G--T--F--V--Q--C--D--A

------------------------------------------------------------><--------------------------------------
--R--A--I--G--S--A--S--E--G--A--Q--S--S--L--Q--E--V--Y--H--K--S--M--T--L--K--E--A--I--K--S--S--L--I-
TCGAGCAATTGGCTCTGCTTCAGAGGGTGCCCAGAGCTCCTTGCAAGAAGTTTACCACAAGTCTATGACTTTGAAAGAAGCCATCAAGTCTTCACTCATC
:::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::::::: .::::::::::::::::.::::::::::: 
TCGAGCAATCGGCTCTGCTTCAGAGGGTGCCCAGAGCTCCTTGCAAGAAGTCTACCACAAGTCTATGACACTGAAAGAAGCCATCAAATCTTCACTCATA
--R--A--I--G--S--A--S--E--G--A--Q--S--S--L--Q--E--V--Y--H--K--S--M--T--L--K--E--A--I--K--S--S--L--I-

-----------------------------------------------><---------------------------------------------------
-I--L--K--Q--V--M--E--E--K--L--N--A--T--N--I--E--L--A--T--V--Q--P--G--Q--N--F--H--M--F--T--K--E--E--
ATCCTCAAACAAGTAATGGAGGAGAAGCTGAATGCAACAAACATTGAGCTAGCCACAGTGCAGCCTGGCCAGAATTTCCACATGTTCACAAAGGAAGAAC
::::::::.:::::::::::::::::.::::::::::: ::::: :::::::::::::::::.:::::::::::::::::::::::::::::::::::::
ATCCTCAAGCAAGTAATGGAGGAGAAACTGAATGCAACTAACATAGAGCTAGCCACAGTGCAACCTGGCCAGAATTTCCACATGTTCACAAAGGAAGAAC
-I--L--K--Q--V--M--E--E--K--L--N--A--T--N--I--E--L--A--T--V--Q--P--G--Q--N--F--H--M--F--T--K--E--E--

------------------------->
L--E--E--V--I--K--D--I--*-
TTGAAGAGGTTATCAAGGACATTTAA
:.::::::::::::::::::::::::
TCGAAGAGGTTATCAAGGACATTTAA
L--E--E--V--I--K--D--I--*-

Pig Consensus Sequence

>BGISUST0000893280
------------------------------------------------------------------------------------------------CTTG
GTTCTACAGCCATTGGGATCCAGACATCAGAGGGTGTGTGCCTAGCTGTGGAGAAGAGAATTACCTCTCCGCTCATGGAGCCCAGCAGCATTGAGAAGAT
TGTAGAGATTGATGCTCACATA---------------------------------------------------------------------AACCACTGG
TTCACCTACAATGAGACAATGACAGTAGAGAGTGTGACTCAGGCTGTGTCAAATCTGGCTCTCCAGTTTGGAGAAGAGGATGCAGATCCAGGTGCCATGT
CTCGTCCCTTCGGAGTAGCACTGTTATTTGGAGGAGTTGATGAAAAAGGACCCCAG---TTTCATATGGATCCATCTGGAACGTTTGTACAGTGTGATGC
TCGAGCAATCGGCTCTGCTTCAGAGGGTGCCCAGAGCTCCTTGCAAGAAGTCTACCACAAGTCTATGACACTGAAAGAAGCCATCAAATCTTCACTCATA
ATCCTCAAGCAAGTAATGGAGGAGAAACTGAATGCAACTAACATAGAGCTAGCCACAGTGCAACCTGGCCAGAATTTCCACATGTTCACAAAGGAAGAAC
TCGAAGAGGTTATCAAGGACATTTAA


>BGISUSP0000893280
--------------------------------LGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHI-----------------------NHW
FTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQ-FHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLI
ILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI*