Sequences
EST Library Info
plac6Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000143126 (click for geneview)
Transcript ID ENST00000271332(link to ensembl)
Symbol CELSR2
Localtion Chromosome:1:109504683:109530414:1 band: 1p13.3
Description Cadherin EGF LAG seven-pass G-type receptor 2 precursor (Epidermal growth factor-like 2) (Multiple epidermal growth factor-like domains 3) (Flamingo 1). [Source:Uniprot/SWISSPROT;Acc:Q9HCU4]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--R--S--P--A--T--G--V--P--L--P--T--P--P--P--P--L--L--L--L--L--L--L--L--L--P--P--P--L--L--G--D--Q--
ATGCGGAGCCCGGCCACCGGCGTCCCCCTCCCAACGCCGCCGCCGCCGCTGCTGCTGCTGTTGCTGCTGCTGCTGCCGCCGCCACTATTGGGAGACCAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--G--P--C--R--S--L--G--S--R--G--R--G--S--S--G--A--C--A--P--M--G--W--L--C--P--S--S--A--S--N--L--W--L
TGGGGCCCTGTCGTTCCTTGGGGTCCAGGGGACGAGGCTCTTCGGGGGCCTGCGCCCCCATGGGCTGGCTCTGTCCATCCTCAGCGTCGAACCTCTGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Y--T--S--R--C--R--D--A--G--T--E--L--T--G--H--L--V--P--H--H--D--G--L--R--V--W--C--P--E--S--E--A--H-
CTACACCAGCCGCTGCAGGGATGCGGGCACTGAGCTGACTGGCCACCTGGTACCCCACCACGATGGCCTGAGGGTTTGGTGTCCAGAATCCGAGGCCCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--P--L--P--P--A--P--E--G--C--P--W--S--C--R--L--L--G--I--G--G--H--L--S--P--Q--G--K--L--T--L--P--E--
ATTCCCCTACCACCAGCTCCTGAAGGCTGCCCCTGGAGCTGTCGCCTCCTGGGCATTGGAGGCCACCTTTCCCCACAGGGCAAGCTCACACTGCCCGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--H--P--C--L--K--A--P--R--L--R--C--Q--S--C--K--L--A--Q--A--P--G--L--R--A--G--E--R--S--P--E--E--S--L
AGCACCCGTGCTTAAAGGCTCCACGGCTCAGATGCCAGTCCTGCAAGCTGGCACAGGCCCCCGGGCTCAGGGCAGGGGAAAGGTCACCAGAAGAGTCCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--G--R--R--K--R--N--V--N--T--A--P--Q--F--Q--P--P--S--Y--Q--A--T--V--P--E--N--Q--P--A--G--T--P--V-
GGGTGGGCGTCGGAAAAGGAATGTAAATACAGCCCCCCAGTTCCAGCCCCCCAGCTACCAGGCCACAGTGCCGGAGAACCAGCCAGCAGGCACCCCTGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--S--L--R--A--I--D--P--D--E--G--E--A--G--R--L--E--Y--T--M--D--A--L--F--D--S--R--S--N--Q--F--F--S--
GCATCCCTGAGGGCCATCGACCCGGACGAGGGTGAGGCAGGTCGACTGGAGTACACCATGGATGCCCTCTTTGATAGCCGCTCCAACCAGTTCTTCTCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--D--P--V--T--G--A--V--T--T--A--E--E--L--D--R--E--T--K--S--T--H--V--F--R--V--T--A--Q--D--H--G--M--P
TGGACCCAGTCACTGGTGCAGTAACCACAGCCGAGGAGCTGGATCGTGAGACCAAGAGCACCCACGTCTTCAGGGTCACGGCGCAGGACCACGGCATGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--R--S--A--L--A--T--L--T--I--L--V--T--D--T--N--D--H--D--P--V--F--E--Q--Q--E--Y--K--E--S--L--R--E-
CCGACGAAGTGCCCTGGCTACACTCACCATCTTGGTTACTGACACCAATGACCATGACCCTGTGTTCGAGCAGCAGGAGTACAAGGAGAGCCTCAGGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--L--E--V--G--Y--E--V--L--T--V--R--A--T--D--G--D--A--P--P--N--A--N--I--L--Y--R--L--L--E--G--S--G--
AACCTGGAGGTTGGCTATGAGGTGCTCACTGTCAGGGCCACGGATGGTGATGCCCCTCCCAATGCCAATATTCTGTACCGCCTGCTGGAGGGGTCTGGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--S--P--S--E--V--F--E--I--D--P--R--S--G--V--I--R--T--R--G--P--V--D--R--E--E--V--E--S--Y--Q--L--T--V
GCAGCCCCTCTGAAGTCTTTGAGATCGACCCTCGCTCTGGGGTGATCCGAACCCGTGGCCCTGTGGATCGGGAAGAGGTGGAATCCTACCAGCTGACGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--A--S--D--Q--G--R--D--P--G--P--R--S--T--T--A--A--V--F--L--S--V--E--D--D--N--D--N--A--P--Q--F--S-
AGAGGCAAGTGACCAGGGTCGGGACCCGGGTCCTCGGAGTACCACAGCCGCTGTTTTCCTTTCTGTGGAGGATGACAATGATAATGCCCCCCAGTTTAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--K--R--Y--V--V--Q--V--R--E--D--V--T--P--G--A--P--V--L--R--V--T--A--S--D--R--D--K--G--S--N--A--V--
GAGAAGCGCTATGTGGTCCAGGTGAGGGAGGATGTGACTCCAGGGGCCCCAGTACTCCGAGTCACAGCCTCGGATCGAGACAAGGGGAGCAATGCCGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--H--Y--S--I--M--S--G--N--A--R--G--Q--F--Y--L--D--A--Q--T--G--A--L--D--V--V--S--P--L--D--Y--E--T--T
TGCACTATAGCATCATGAGTGGCAATGCTCGGGGACAGTTTTATCTGGATGCCCAGACTGGAGCTCTGGATGTGGTGAGCCCTCTTGACTATGAGACGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--E--Y--T--L--R--V--R--A--Q--D--G--G--R--P--P--L--S--N--V--S--G--L--V--T--V--Q--V--L--D--I--N--D-
CAAGGAGTACACCCTACGGGTGCGAGCACAGGATGGTGGCCGTCCCCCACTCTCTAATGTCTCTGGCTTGGTGACAGTACAGGTCCTGGATATCAACGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--A--P--I--F--V--S--T--P--F--Q--A--T--V--L--E--S--V--P--L--G--Y--L--V--L--H--V--Q--A--I--D--A--D--
AATGCCCCCATCTTCGTCAGCACCCCTTTCCAGGCTACTGTCCTGGAGAGTGTCCCCTTAGGCTACCTGGTTCTCCATGTCCAGGCTATCGACGCTGATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--G--D--N--A--R--L--E--Y--R--L--A--G--V--G--H--D--F--P--F--T--I--N--N--G--T--G--W--I--S--V--A--A--E
CTGGTGACAATGCCCGCCTGGAATACCGCCTTGCTGGGGTGGGACATGACTTCCCCTTCACCATCAACAATGGCACAGGCTGGATCTCTGTGGCTGCTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--D--R--E--E--V--D--F--Y--S--F--G--V--E--A--R--D--H--G--T--P--A--L--T--A--S--A--S--V--S--V--T--V-
ACTGGACCGGGAGGAAGTTGATTTCTACAGCTTTGGGGTAGAAGCTCGAGACCATGGCACTCCAGCACTCACTGCCTCGGCCAGTGTCAGCGTGACTGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--D--V--N--D--N--N--P--T--F--T--Q--P--E--Y--T--V--R--L--N--E--D--A--A--V--G--T--S--V--V--T--V--S--
CTGGATGTCAACGACAACAATCCAACCTTTACCCAACCAGAGTACACAGTGCGGCTCAATGAGGATGCAGCTGTGGGCACCAGCGTGGTGACGGTGTCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--V--D--R--D--A--H--S--V--I--T--Y--Q--I--T--S--G--N--T--R--N--R--F--S--I--T--S--Q--S--G--G--G--L--V
CTGTGGACCGTGATGCTCATAGTGTCATCACCTACCAGATCACCAGTGGCAATACTCGAAACCGCTTCTCCATCACCAGCCAAAGTGGTGGTGGGCTGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--L--A--L--P--L--D--Y--K--L--E--R--Q--Y--V--L--A--V--T--A--S--D--G--T--R--Q--D--T--A--Q--I--V--V-
ATCCCTTGCCCTGCCACTGGACTACAAACTTGAGCGGCAGTATGTGTTGGCTGTTACCGCCTCCGATGGCACTCGGCAGGACACGGCACAGATTGTGGTG
                                                             ::.:::::::: ::::::::::: :: ::..: ::::::
-------------------------------------------------------------TCTGATGGCACACGGCAGGACACCGCCCAAGTGGTGGTG
--------------------------------------------------------------S--D--G--T--R--Q--D--T--A--Q--V--V--V-

----------------------------------------------------------------------------------------------------
-N--V--T--D--A--N--T--H--R--P--V--F--Q--S--S--H--Y--T--V--N--V--N--E--D--R--P--A--G--T--T--V--V--L--
AATGTCACCGACGCCAACACCCATCGTCCTGTCTTTCAGAGCTCCCACTATACAGTGAATGTTAATGAGGACCGGCCGGCAGGCACCACGGTGGTGCTGA
::::::::.::::::::.:: ::::::::.:: :::::::::::::::::.::.:::::::::::.:::::::::::.:::::::::::.::::::::::
AATGTCACTGACGCCAATACGCATCGTCCCGTGTTTCAGAGCTCCCACTACACGGTGAATGTTAACGAGGACCGGCCAGCAGGCACCACAGTGGTGCTGA
-N--V--T--D--A--N--T--H--R--P--V--F--Q--S--S--H--Y--T--V--N--V--N--E--D--R--P--A--G--T--T--V--V--L--

----------------------------------------------------------------------------------------------------
I--S--A--T--D--E--D--T--G--E--N--A--R--I--T--Y--F--M--E--D--S--I--P--Q--F--R--I--D--A--D--T--G--A--V
TCAGCGCCACGGATGAGGACACAGGTGAGAATGCCCGCATCACCTACTTCATGGAGGACAGCATCCCCCAGTTCCGCATCGATGCAGACACGGGGGCTGT
::::.:::::.::.:::::::: ::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::
TCAGTGCCACAGACGAGGACACCGGTGAGAACGCCCGCATCACCTACTTTATGGAGGACAGCATCCCCCAGTTCCGCATCGATGCAGACACGGGGGCTGT
I--S--A--T--D--E--D--T--G--E--N--A--R--I--T--Y--F--M--E--D--S--I--P--Q--F--R--I--D--A--D--T--G--A--V

----------------------------------------------------------------------------------------------------
--T--T--Q--A--E--L--D--Y--E--D--Q--V--S--Y--T--L--A--I--T--A--R--D--N--G--I--P--Q--K--S--D--T--T--Y-
CACCACCCAGGCTGAGCTGGACTATGAAGACCAAGTGTCTTACACCCTGGCCATTACTGCTCGGGACAATGGCATTCCCCAGAAGTCCGACACCACCTAC
:::::::::.::.:::::::::::.::.:::::.:::::.::::::::::::::.::.::.::::::::.::.::.:::::::::::.::::::::::::
CACCACCCAAGCCGAGCTGGACTACGAGGACCAGGTGTCCTACACCCTGGCCATCACCGCCCGGGACAACGGTATCCCCCAGAAGTCTGACACCACCTAC
--T--T--Q--A--E--L--D--Y--E--D--Q--V--S--Y--T--L--A--I--T--A--R--D--N--G--I--P--Q--K--S--D--T--T--Y-

----------------------------------------------------------------------------------------------------
-L--E--I--L--V--N--D--V--N--D--N--A--P--Q--F--L--R--D--S--Y--Q--G--S--V--Y--E--D--V--P--P--F--T--S--
CTGGAGATCCTGGTGAACGACGTGAATGACAATGCCCCTCAGTTCCTGCGAGACTCCTACCAGGGCAGTGTCTATGAGGATGTGCCACCCTTCACTAGCG
::::::::::::::::::::::::::::::::.::.::::::::::::::.:::::::::::::::::.:::::.::::::::::: ::::::::.::::
CTGGAGATCCTGGTGAACGACGTGAATGACAACGCTCCTCAGTTCCTGCGGGACTCCTACCAGGGCAGCGTCTACGAGGATGTGCCCCCCTTCACCAGCG
-L--E--I--L--V--N--D--V--N--D--N--A--P--Q--F--L--R--D--S--Y--Q--G--S--V--Y--E--D--V--P--P--F--T--S--

----------------------------------------------------------------------------------------------------
V--L--Q--I--S--A--T--D--R--D--S--G--L--N--G--R--V--F--Y--T--F--Q--G--G--D--D--G--D--G--D--F--I--V--E
TCCTGCAGATCTCAGCCACTGATCGTGATTCTGGACTTAATGGCAGGGTCTTCTACACCTTCCAAGGAGGCGACGATGGAGACGGTGACTTTATTGTTGA
::::::::::::::::::::::.:::::.::::: :::::.:::::::::::::::::::::::::: :::::.::::::::.:: ::::::::.:: ::
TCCTGCAGATCTCAGCCACTGACCGTGACTCTGGTCTTAACGGCAGGGTCTTCTACACCTTCCAAGGTGGCGATGATGGAGATGGAGACTTTATCGTAGA
V--L--Q--I--S--A--T--D--R--D--S--G--L--N--G--R--V--F--Y--T--F--Q--G--G--D--D--G--D--G--D--F--I--V--E

----------------------------------------------------------------------------------------------------
--S--T--S--G--I--V--R--T--L--R--R--L--D--R--E--N--V--A--Q--Y--V--L--R--A--Y--A--V--D--K--G--M--P--P-
GTCCACGTCAGGCATCGTGCGAACGCTACGGAGGCTGGATCGAGAGAACGTGGCCCAGTATGTCTTGCGGGCATATGCAGTGGACAAGGGGATGCCCCCA
::::::.:::::::::::::: :::::.:::::::::::::: ::.::.:::::::::::..::.:::::::.:::::::::::::::::::::::.:::
GTCCACATCAGGCATCGTGCGCACGCTGCGGAGGCTGGATCGTGAAAATGTGGCCCAGTACATCCTGCGGGCGTATGCAGTGGACAAGGGGATGCCTCCA
--S--T--S--G--I--V--R--T--L--R--R--L--D--R--E--N--V--A--Q--Y--I--L--R--A--Y--A--V--D--K--G--M--P--P-

----------------------------------------------------------------------------------------------------
-A--R--T--P--M--E--V--T--V--T--V--L--D--V--N--D--N--P--P--V--F--E--Q--D--E--F--D--V--F--V--E--E--N--
GCCCGCACACCTATGGAAGTGACAGTCACTGTGTTGGATGTGAATGACAATCCCCCTGTCTTTGAGCAGGATGAGTTTGATGTGTTTGTGGAAGAGAACA
::::::::.::.:::::.:::::.::::::::::::::::::::::::::::: ::.:::::::::::::::::::::::::::::::::::::::::::
GCCCGCACGCCCATGGAGGTGACGGTCACTGTGTTGGATGTGAATGACAATCCGCCCGTCTTTGAGCAGGATGAGTTTGATGTGTTTGTGGAAGAGAACA
-A--R--T--P--M--E--V--T--V--T--V--L--D--V--N--D--N--P--P--V--F--E--Q--D--E--F--D--V--F--V--E--E--N--

----------------------------------------------------------------------------------------------------
S--P--I--G--L--A--V--A--R--V--T--A--T--D--P--D--E--G--T--N--A--Q--I--M--Y--Q--I--V--E--G--N--I--P--E
GCCCCATTGGGCTAGCCGTGGCCCGGGTCACAGCCACTGACCCCGATGAAGGCACCAATGCCCAGATTATGTACCAGATTGTGGAGGGCAACATCCCTGA
:.:::::::::::.::.::::::::::::::::::::::::::.::.::.::::::::.::::::::.::::::::::::::::::::::::::::::::
GTCCCATTGGGCTGGCTGTGGCCCGGGTCACAGCCACTGACCCTGACGAGGGCACCAACGCCCAGATCATGTACCAGATTGTGGAGGGCAACATCCCTGA
S--P--I--G--L--A--V--A--R--V--T--A--T--D--P--D--E--G--T--N--A--Q--I--M--Y--Q--I--V--E--G--N--I--P--E

----------------------------------------------------------------------------------------------------
--V--F--Q--L--D--I--F--S--G--E--L--T--A--L--V--D--L--D--Y--E--D--R--P--E--Y--V--L--V--I--Q--A--T--S-
GGTCTTTCAGCTGGACATCTTCTCCGGGGAGCTGACAGCCCTGGTAGACTTAGACTACGAGGACCGGCCTGAGTACGTCCTGGTCATCCAGGCCACGTCA
::::::.:::::::::::::::::.::::::::::: ::::::::::::::.:::                                             
GGTCTTCCAGCTGGACATCTTCTCTGGGGAGCTGACCGCCCTGGTAGACTTGGAC---------------------------------------------
--V--F--Q--L--D--I--F--S--G--E--L--T--A--L--V--D--L--D----------------------------------------------

----------------------------------------------------------------------------------------------------
-A--P--L--V--S--R--A--T--V--H--V--R--L--L--D--R--N--D--N--P--P--V--L--G--N--F--E--I--L--F--N--N--Y--
GCTCCTCTGGTGAGCCGGGCTACAGTCCACGTCCGCCTCCTTGACCGCAATGACAACCCACCAGTGCTGGGCAACTTTGAGATCCTTTTCAACAACTATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--T--N--R--S--S--S--F--P--G--G--A--I--G--R--V--P--A--H--D--P--D--I--S--D--S--L--T--Y--S--F--E--R--G
TCACCAATCGCTCAAGCAGCTTCCCTGGGGGTGCCATTGGCCGAGTACCTGCCCATGACCCTGATATCTCAGATAGTCTGACTTACAGCTTTGAGCGGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--E--L--S--L--V--L--L--N--A--S--T--G--E--L--K--L--S--R--A--L--D--N--N--R--P--L--E--A--I--M--S--V-
AAATGAACTCAGCCTGGTCCTGCTCAATGCCTCCACGGGTGAGCTGAAGCTAAGCCGCGCACTGGACAACAACCGGCCTCTGGAGGCCATCATGAGCGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------><-----------------------------------------------------------------------------------------
-L--V--S--D--G--V--H--S--V--T--A--Q--C--A--L--R--V--T--I--I--T--D--E--M--L--T--H--S--I--T--L--R--L--
CTGGTGTCAGACGGCGTACACAGCGTGACCGCCCAGTGCGCGCTGCGTGTGACCATCATCACCGATGAGATGCTCACCCACAGCATCACGCTGCGCCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--D--M--S--P--E--R--F--L--S--P--L--L--G--L--F--I--Q--A--V--A--A--T--L--A--T--P--P--D--H--V--V--V--F
AGGACATGTCACCCGAGCGCTTCCTGTCACCACTGCTAGGCCTCTTCATCCAGGCGGTGGCCGCCACGCTGGCCACGCCACCGGACCACGTGGTGGTCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--V--Q--R--D--T--D--A--P--G--G--H--I--L--N--V--S--L--S--V--G--Q--P--P--G--P--G--G--G--P--P--F--L-
CAACGTACAGCGGGACACCGACGCCCCCGGGGGCCACATCCTCAACGTGAGCCTGTCGGTGGGCCAGCCGCCAGGGCCCGGGGGCGGGCCGCCCTTCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--S--E--D--L--Q--E--R--L--Y--L--N--R--S--L--L--T--A--I--S--A--Q--R--V--L--P--F--D--D--N--I--C--L--
CCCTCTGAGGACCTGCAGGAGCGCCTATACCTCAACCGCAGCCTGCTGACGGCCATCTCGGCACAGCGCGTGCTGCCCTTCGACGACAACATCTGCCTGC
   :: ::::::::::::::::::::.:::::::::::::::::::::::::::::::: ::.:::::::::::::::::::::::::::::::::::::
---TCGGAGGACCTGCAGGAGCGCCTGTACCTCAACCGCAGCCTGCTGACGGCCATCTCCGCGCAGCGCGTGCTGCCCTTCGACGACAACATCTGCCTGC
----S--E--D--L--Q--E--R--L--Y--L--N--R--S--L--L--T--A--I--S--A--Q--R--V--L--P--F--D--D--N--I--C--L--

----------------------------------------------------------------------------------------------------
R--E--P--C--E--N--Y--M--R--C--V--S--V--L--R--F--D--S--S--A--P--F--I--A--S--S--S--V--L--F--R--P--I--H
GGGAGCCCTGCGAGAACTACATGCGCTGCGTGTCGGTGCTGCGCTTCGACTCCTCCGCGCCCTTCATCGCCTCCTCCTCCGTGCTCTTCCGGCCCATCCA
: ::::::::::::::::::::::::::::::::::: ::::::::::::::::: :::::::::::: :::::::::::::::::::::::::::::::
GCGAGCCCTGCGAGAACTACATGCGCTGCGTGTCGGTCCTGCGCTTCGACTCCTCGGCGCCCTTCATCTCCTCCTCCTCCGTGCTCTTCCGGCCCATCCA
R--E--P--C--E--N--Y--M--R--C--V--S--V--L--R--F--D--S--S--A--P--F--I--S--S--S--S--V--L--F--R--P--I--H

----------------------------------------------------------------------------------------------------
--P--V--G--G--L--R--C--R--C--P--P--G--F--T--G--D--Y--C--E--T--E--V--D--L--C--Y--S--R--P--C--G--P--H-
CCCCGTCGGAGGGCTGCGCTGCCGCTGCCCGCCCGGCTTCACGGGTGACTACTGCGAGACCGAGGTGGACCTCTGCTACTCGCGGCCCTGTGGCCCCCAC
::: :::::.::::::::::::::::::::::: :::::::: ::::::::::::::::: :::::::::::::::::::::::::::::.: :::::::
CCCGGTCGGGGGGCTGCGCTGCCGCTGCCCGCCAGGCTTCACCGGTGACTACTGCGAGACGGAGGTGGACCTCTGCTACTCGCGGCCCTGCGCCCCCCAC
--P--V--G--G--L--R--C--R--C--P--P--G--F--T--G--D--Y--C--E--T--E--V--D--L--C--Y--S--R--P--C--A--P--H-

---------------------------------------------------------><-----------------------------------------
-G--R--C--R--S--R--E--G--G--Y--T--C--L--C--R--D--G--Y--T--G--E--H--C--E--V--S--A--R--S--G--R--C--T--
GGGCGCTGCCGCAGCCGCGAGGGCGGCTACACCTGCCTCTGTCGTGATGGCTACACGGGTGAGCACTGTGAGGTGAGTGCTCGCTCAGGCCGTTGCACCC
:::::::::::::::::.:::::::::::::::::::::::.:: :: :::::::::                                           
GGGCGCTGCCGCAGCCGTGAGGGCGGCTACACCTGCCTCTGCCGAGAGGGCTACACG-------------------------------------------
-G--R--C--R--S--R--E--G--G--Y--T--C--L--C--R--E--G--Y--T--------------------------------------------

----------------------------------------------------------------------------------------------------
P--G--V--C--K--N--G--G--T--C--V--N--L--L--V--G--G--F--K--C--D--C--P--S--G--D--F--E--K--P--Y--C--Q--V
CGGGTGTCTGCAAGAATGGGGGCACCTGTGTCAACCTGCTGGTGGGCGGTTTCAAGTGCGATTGCCCATCTGGAGACTTCGAGAAGCCCTACTGCCAGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------><------------------
--T--T--R--S--F--P--A--H--S--F--I--T--F--R--G--L--R--Q--R--F--H--F--T--L--A--L--S--F--A--T--K--E--R-
GACCACGCGCAGCTTCCCCGCCCACTCCTTCATCACCTTTCGCGGCCTGCGCCAGCGTTTCCACTTCACCCTGGCCCTCTCGTTTGCCACAAAGGAGCGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------------------><--
-D--G--L--L--L--Y--N--G--R--F--N--E--K--H--D--F--V--A--L--E--V--I--Q--E--Q--V--Q--L--T--F--S--A--G--
GACGGGTTGCTGTTGTACAATGGGCGTTTCAATGAGAAGCATGACTTTGTGGCCCTCGAGGTGATCCAGGAGCAGGTCCAGCTCACCTTCTCTGCAGGGG
               :::::.:::::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :
---------------TACAACGGGCGCTTCAACGAGAAGCATGACTTTGTGGCCCTCGAGGTGATCCAGGAGCAGGTCCAGCTCACCTTCTCTGCA---G
----------------Y--N--G--R--F--N--E--K--H--D--F--V--A--L--E--V--I--Q--E--Q--V--Q--L--T--F--S--A-----

-------------------------------------------------------------------------------------><-------------
E--S--T--T--T--V--S--P--F--V--P--G--G--V--S--D--G--Q--W--H--T--V--Q--L--K--Y--Y--N--K--P--L--L--G--Q
AGTCAACCACCACGGTGTCCCCATTCGTGCCCGGAGGAGTCAGTGATGGCCAGTGGCATACGGTGCAGCTGAAATACTACAATAAGCCACTGTTGGGTCA
::::.:::::::: :::::::::::::::::::::::.::::::::.:::::::::::.::::::::::::::.::::::::::::              
AGTCGACCACCACTGTGTCCCCATTCGTGCCCGGAGGGGTCAGTGACGGCCAGTGGCACACGGTGCAGCTGAAGTACTACAATAAG--------------
E--S--T--T--T--V--S--P--F--V--P--G--G--V--S--D--G--Q--W--H--T--V--Q--L--K--Y--Y--N--K---------------

----------------------------------------------------------------------------------------------------
--T--G--L--P--Q--G--P--S--E--Q--K--V--A--V--V--T--V--D--G--C--D--T--G--V--A--L--R--F--G--S--V--L--G-
GACAGGGCTCCCACAGGGCCCATCAGAGCAGAAGGTGGCTGTGGTGACCGTGGATGGCTGTGACACAGGAGTGGCCTTGCGCTTCGGATCTGTCCTGGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------><-------------------------------------------------------
-N--Y--S--C--A--A--Q--G--T--Q--G--G--S--K--K--S--L--D--L--T--G--P--L--L--L--G--G--V--P--D--L--P--E--
AACTACTCCTGTGCTGCCCAGGGCACCCAGGGTGGCAGCAAGAAGTCTCTGGATCTGACGGGGCCCCTGCTACTAGGCGGGGTGCCTGACCTGCCCGAGA
                                             ::::::::.:::::::::::::::::.::.:::::::: ::::::::::::::::
---------------------------------------------TCTCTGGACCTGACGGGGCCCCTGCTGCTGGGCGGGGTCCCTGACCTGCCCGAGA
----------------------------------------------S--L--D--L--T--G--P--L--L--L--G--G--V--P--D--L--P--E--

----------------------------------------------------------------------------------------------------
S--F--P--V--R--M--R--Q--F--V--G--C--M--R--N--L--Q--V--D--S--R--H--I--D--M--A--D--F--I--A--N--N--G--T
GCTTCCCAGTCCGAATGCGGCAGTTCGTGGGCTGCATGCGGAACCTGCAGGTGGACAGCCGGCACATAGACATGGCTGACTTCATTGCCAACAATGGCAC
::::::: ::::: :.:::::: ::::::::::::::: ::::::::::::::::.:::::.:::.: ::::::::.:::::::::::::::::::::::
GCTTCCCTGTCCGCACGCGGCACTTCGTGGGCTGCATGAGGAACCTGCAGGTGGATAGCCGACACGTCGACATGGCCGACTTCATTGCCAACAATGGCAC
S--F--P--V--R--T--R--H--F--V--G--C--M--R--N--L--Q--V--D--S--R--H--V--D--M--A--D--F--I--A--N--N--G--T

-------><-------------------------------------------------------------------------------------------
--V--P--G--C--P--A--K--K--N--V--C--D--S--N--T--C--H--N--G--G--T--C--V--N--Q--W--D--A--F--S--C--E--C-
CGTGCCTGGCTGCCCTGCCAAGAAGAACGTGTGTGACAGCAACACTTGCCACAATGGGGGCACTTGCGTGAACCAGTGGGACGCGTTCAGCTGCGAGTGC
:::::::   :::::::::::::::::.:::::.:::::::::::.:::::::::::::::::.::.::::::::::::::.:::::::::::: :::::
CGTGCCT---TGCCCTGCCAAGAAGAATGTGTGCGACAGCAACACCTGCCACAATGGGGGCACCTGTGTGAACCAGTGGGATGCGTTCAGCTGCCAGTGC
--V--P-----C--P--A--K--K--N--V--C--D--S--N--T--C--H--N--G--G--T--C--V--N--Q--W--D--A--F--S--C--Q--C-

------------------------------------><--------------------------------------------------------------
-P--L--G--F--G--G--K--S--C--A--Q--E--M--A--N--P--Q--H--F--L--G--S--S--L--V--A--W--H--G--L--S--L--P--
CCCCTGGGCTTTGGGGGCAAGAGCTGCGCCCAGGAAATGGCCAATCCACAGCACTTCCTGGGCAGCAGCCTGGTGGCCTGGCATGGCCTCTCGCTGCCCA
::.:::::::: ::::::::::::::.::::::         ::.::.::::.::::::::::::::::.:::::::::::::.::::::::.:::::::
CCTCTGGGCTT-GGGGGCAAGAGCTGTGCCCAG---------AACCCGCAGCGCTTCCTGGGCAGCAGCTTGGTGGCCTGGCACGGCCTCTCACTGCCCA
-P--L--G--F--G--G--K--S--C--A--Q-----------N--P--Q--R--F--L--G--S--S--L--V--A--W--H--G--L--S--L--P--

----------------------------------------------------------------------------------------------------
I--S--Q--P--W--Y--L--S--L--M--F--R--T--R--Q--A--D--G--V--L--L--Q--A--I--T--R--G--R--S--T--I--T--L--Q
TCTCCCAACCCTGGTACCTCAGCCTCATGTTCCGCACGCGCCAGGCCGACGGTGTCCTGCTGCAGGCCATCACCAGGGGGCGCAGCACCATCACCCTACA
:::::::.::::::.:::::::::::::::::::.:::::::::::::::::.:::::.::::::::..:::: ::::::::::::::.::::::::.::
TCTCCCAGCCCTGGCACCTCAGCCTCATGTTCCGTACGCGCCAGGCCGACGGCGTCCTACTGCAGGCTGTCACGAGGGGGCGCAGCACTATCACCCTGCA
I--S--Q--P--W--H--L--S--L--M--F--R--T--R--Q--A--D--G--V--L--L--Q--A--V--T--R--G--R--S--T--I--T--L--Q

---><-----------------------------------------------------------------------------------------------
--L--R--E--G--H--V--M--L--S--V--E--G--T--G--L--Q--A--S--S--L--R--L--E--P--G--R--A--N--D--G--D--W--H-
GCTACGAGAGGGCCACGTGATGCTGAGCGTGGAGGGCACAGGGCTTCAGGCCTCCTCTCTCCGTCTGGAGCCAGGCCGGGCCAATGACGGTGACTGGCAC
:                                                                                                   
G---------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--A--Q--L--A--L--G--A--S--G--G--P--G--H--A--I--L--S--F--D--Y--G--Q--Q--R--A--E--G--N--L--G--P--R--
CATGCACAGCTGGCACTGGGAGCCAGCGGGGGGCCCGGCCATGCCATTCTGTCCTTCGATTATGGGCAGCAGAGAGCAGAGGGCAACCTGGGCCCCCGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------><-------
L--H--G--L--H--L--S--N--I--T--V--G--G--I--P--G--P--A--G--G--V--A--R--G--F--R--G--C--L--Q--G--V--R--V
TGCATGGTCTGCACCTGAGCAACATAACAGTGGGCGGAATACCTGGGCCAGCCGGCGGTGTGGCCCGTGGCTTTCGGGGCTGTTTGCAGGGTGTGCGGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--D--T--P--E--G--V--N--S--L--D--P--S--H--G--E--S--I--N--V--E--Q--G--C--S--L--P--D--P--C--D--S--N-
GAGCGATACGCCGGAGGGGGTTAACAGCCTGGATCCCAGCCATGGGGAGAGCATCAACGTGGAGCAAGGCTGTAGCCTGCCTGACCCTTGTGACTCAAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------><--------------------------------
-P--C--P--A--N--S--Y--C--S--N--D--W--D--S--Y--S--C--S--C--D--P--G--Y--Y--G--D--N--C--T--N--V--C--D--
CCGTGTCCTGCTAACAGCTATTGCAGCAACGACTGGGACAGCTATTCCTGCAGCTGTGATCCAGGTTACTATGGTGACAACTGTACTAATGTGTGTGACC
                                                                  :::::::::::::::::.:::::.::::::::::
------------------------------------------------------------------TACTATGGTGACAACTGCACTAACGTGTGTGACC
-------------------------------------------------------------------Y--Y--G--D--N--C--T--N--V--C--D--

----------------------------------------------------------------------------------------------------
L--N--P--C--E--H--Q--S--V--C--T--R--K--P--S--A--P--H--G--Y--T--C--E--C--P--P--N--Y--L--G--P--Y--C--E
TGAACCCGTGTGAGCACCAGTCTGTGTGTACCCGCAAGCCCAGTGCCCCCCATGGCTATACCTGCGAGTGTCCCCCAAATTACCTTGGGCCATACTGTGA
:::::::.::::::::.:: ::..:.:::::::: :::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::
TGAACCCATGTGAGCATCACTCCATATGTACCCGAAAGCCCAGTGCCCCCCATGGCTATACCTGCGAGTGTCCCCAAAATTACCTTGGGCCATACTGTGA
L--N--P--C--E--H--H--S--I--C--T--R--K--P--S--A--P--H--G--Y--T--C--E--C--P--Q--N--Y--L--G--P--Y--C--E

--------><------------------------------------------------------------------------------------------
--T--R--I--D--Q--P--C--P--R--G--W--W--G--H--P--T--C--G--P--C--N--C--D--V--S--K--G--F--D--P--D--C--N-
GACCAGGATTGACCAGCCTTGTCCCCGTGGCTGGTGGGGACATCCCACATGTGGCCCATGCAACTGTGATGTCAGCAAAGGCTTTGACCCAGACTGCAAC
::::   ::::::::::::::.::::: ::::::::::::::.::::: ::.:::::::::::::::::.::::::::::::::.::.::::::::::::
GACC---ATTGACCAGCCTTGCCCCCGAGGCTGGTGGGGACACCCCACCTGCGGCCCATGCAACTGTGACGTCAGCAAAGGCTTCGATCCAGACTGCAAC
--T-----I--D--Q--P--C--P--R--G--W--W--G--H--P--T--C--G--P--C--N--C--D--V--S--K--G--F--D--P--D--C--N-

-----------------------------><---------------------------------------------------------------------
-K--T--S--G--E--C--H--C--K--E--N--H--Y--R--P--P--G--S--P--T--C--L--L--C--D--C--Y--P--T--G--S--L--S--
AAGACAAGCGGCGAGTGCCACTGCAAGGAGAACCACTACCGGCCCCCAGGCAGCCCCACCTGCCTCTTGTGTGACTGCTACCCCACAGGCTCCTTGTCCA
:::::.::::::::::::::::::::::::::::::::::::::::: ::::::::: ::::::::.:::::::::::::::::::.:::::..::::: 
AAGACGAGCGGCGAGTGCCACTGCAAGGAGAACCACTACCGGCCCCCTGGCAGCCCCTCCTGCCTCCTGTGTGACTGCTACCCCACGGGCTCTCTGTCCC
-K--T--S--G--E--C--H--C--K--E--N--H--Y--R--P--P--G--S--P--S--C--L--L--C--D--C--Y--P--T--G--S--L--S--

----------------------------------------------------------------------------------------------------
R--V--C--D--P--E--D--G--Q--C--P--C--K--P--G--V--I--G--R--Q--C--D--R--C--D--N--P--F--A--E--V--T--T--N
GAGTCTGTGACCCTGAGGATGGCCAGTGTCCATGCAAGCCAGGTGTCATCGGGCGTCAGTGTGACCGCTGTGACAACCCTTTTGCTGAGGTCACCACCAA
:::::::::::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::
GAGTCTGTGACCCCGAGGATGGCCAGTGTCCATGCAAGCCAGGTGTCATTGGGCGTCAGTGTGACCGCTGTGACAACCCTTTTGCTGAGGTTACCACCAA
R--V--C--D--P--E--D--G--Q--C--P--C--K--P--G--V--I--G--R--Q--C--D--R--C--D--N--P--F--A--E--V--T--T--N

-------------><-------------------------------------------------------------------------------------
--G--C--E--V--N--Y--D--S--C--P--R--A--I--E--A--G--I--W--W--P--R--T--R--F--G--L--P--A--A--A--P--C--P-
TGGCTGTGAAGTGAATTATGACAGCTGCCCACGAGCGATTGAGGCTGGGATCTGGTGGCCCCGTACCCGCTTCGGGCTGCCTGCTGCTGCTCCCTGTCCC
.:::::::::   :::::.::::::::::: ::::: :::::::: ::.:::::::::::::::::::::::.:::::::::::::::::.:::::.:::
CGGCTGTGAA---AATTACGACAGCTGCCCCCGAGCTATTGAGGCGGGAATCTGGTGGCCCCGTACCCGCTTTGGGCTGCCTGCTGCTGCCCCCTGCCCC
--G--C--E-----N--Y--D--S--C--P--R--A--I--E--A--G--I--W--W--P--R--T--R--F--G--L--P--A--A--A--P--C--P-

---------------><-----------------------------------------------------------------------------------
-K--G--S--F--G--T--A--V--R--H--C--D--E--H--R--G--W--L--P--P--N--L--F--N--C--T--S--I--T--F--S--E--L--
AAAGGCTCCTTTGGGACTGCTGTGCGCCACTGTGATGAGCACAGGGGGTGGCTCCCCCCAAACCTCTTCAACTGCACGTCCATCACCTTCTCAGAACTGA
::::::::::::   ::.:::::::::::::::::.:::::: :.::::::::::: ::::::::::::::::::::::::.::::::::::.::.::::
AAAGGCTCCTTT---ACCGCTGTGCGCCACTGTGACGAGCACCGAGGGTGGCTCCCGCCAAACCTCTTCAACTGCACGTCCGTCACCTTCTCGGAGCTGA
-K--G--S--F-----T--A--V--R--H--C--D--E--H--R--G--W--L--P--P--N--L--F--N--C--T--S--V--T--F--S--E--L--

----------><----------------------------------------------------------------------------------------
K--G--F--A--E--R--L--Q--R--N--E--S--G--L--D--S--G--R--S--Q--Q--L--A--L--L--L--R--N--A--T--Q--H--T--A
AGGGCTTCGCTGAGCGGCTACAGCGGAATGAGTCAGGCCTAGACTCAGGGCGCTCCCAGCAGCTAGCCCTGCTCCTGCGCAACGCCACGCAGCACACAGC
:::::   :::::::::::.:::::.::::::::::::::.:::::.:::::::::::::.:::.::::::::.:::::::::::.:: :::::::::::
AGGGC---GCTGAGCGGCTGCAGCGAAATGAGTCAGGCCTGGACTCGGGGCGCTCCCAGCGGCTGGCCCTGCTTCTGCGCAACGCTACCCAGCACACAGC
K--G-----A--E--R--L--Q--R--N--E--S--G--L--D--S--G--R--S--Q--R--L--A--L--L--L--R--N--A--T--Q--H--T--A

----------------------------------------------------------------------------------------------------
--G--Y--F--G--S--D--V--K--V--A--Y--Q--L--A--T--R--L--L--A--H--E--S--T--Q--R--G--F--G--L--S--A--T--Q-
TGGCTACTTCGGCAGCGACGTCAAGGTGGCCTACCAGCTGGCCACGCGGCTGCTGGCCCACGAGAGCACCCAGCGGGGCTTTGGGCTGTCTGCCACACAG
::::::::::::::::::.::::::::::::::::::::::::::. ::::.::.::::::::::::.:::::::::::::.::::::::.:::::.:::
TGGCTACTTCGGCAGCGATGTCAAGGTGGCCTACCAGCTGGCCACAAGGCTACTAGCCCACGAGAGCGCCCAGCGGGGCTTCGGGCTGTCCGCCACGCAG
--G--Y--F--G--S--D--V--K--V--A--Y--Q--L--A--T--R--L--L--A--H--E--S--A--Q--R--G--F--G--L--S--A--T--Q-

--------------------><------------------------------------------------------------------------------
-D--V--H--F--T--E--N--L--L--R--V--G--S--A--L--L--D--T--A--N--K--R--H--W--E--L--I--Q--Q--T--E--G--G--
GACGTGCACTTCACTGAGAATCTGCTGCGGGTGGGCAGCGCCCTCCTGGACACAGCCAACAAGCGGCACTGGGAGCTGATCCAGCAGACAGAGGGTGGCA
::.:::::::::::::::::::::::::::::::::::::::::::::::..:::::::::::::::::::::::::::::::::::::.::::: ::::
GATGTGCACTTCACTGAGAATCTGCTGCGGGTGGGCAGCGCCCTCCTGGATGCAGCCAACAAGCGGCACTGGGAGCTGATCCAGCAGACGGAGGGGGGCA
-D--V--H--F--T--E--N--L--L--R--V--G--S--A--L--L--D--A--A--N--K--R--H--W--E--L--I--Q--Q--T--E--G--G--

----------------------------------------------------------------------------------------------------
T--A--W--L--L--Q--H--Y--E--A--Y--A--S--A--L--A--Q--N--M--R--H--T--Y--L--S--P--F--T--I--V--T--P--N--I
CCGCCTGGCTGCTCCAGCACTATGAGGCCTACGCCAGTGCCCTGGCCCAGAACATGCGGCACACCTACCTAAGCCCCTTCACCATCGTCACGCCCAACAT
:.::::::::::: ::::::::.::::::::::::::.:::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::
CTGCCTGGCTGCTGCAGCACTACGAGGCCTACGCCAGCGCCCTGGCCCAGAACATGCGGCACACCTACCTCAGCCCCTTCACCATCGTCACGCCCAACAT
T--A--W--L--L--Q--H--Y--E--A--Y--A--S--A--L--A--Q--N--M--R--H--T--Y--L--S--P--F--T--I--V--T--P--N--I

----><----------------------------------------------------------------------------------------------
--V--I--S--V--V--R--L--D--K--G--N--F--A--G--A--K--L--P--R--Y--E--A--L--R--G--E--Q--P--P--D--L--E--T-
TGTCATCTCCGTAGTGCGCTTGGACAAAGGGAACTTTGCTGGGGCCAAGCTGCCCCGCTACGAGGCCCTGCGTGGGGAGCAGCCCCCGGACCTTGAGACA
:   :::::.::.:: :::::::::::.::::::::.:: :::::::::::::::::.:::::::: ::::: :::::::.:::::::::::::::::::
T---ATCTCTGTGGTTCGCTTGGACAAGGGGAACTTCGCGGGGGCCAAGCTGCCCCGTTACGAGGCGCTGCGGGGGGAGCGGCCCCCGGACCTTGAGACA
-----I--S--V--V--R--L--D--K--G--N--F--A--G--A--K--L--P--R--Y--E--A--L--R--G--E--R--P--P--D--L--E--T-

---------------------------------><-----------------------------------------------------------------
-T--V--I--L--P--E--S--V--F--R--E--T--P--P--V--V--R--P--A--G--P--G--E--A--Q--E--P--E--E--L--A--R--R--
ACAGTCATTCTGCCTGAGTCTGTCTTCAGAGAGACGCCCCCCGTGGTCAGGCCCGCAGGCCCCGGAGAGGCCCAGGAGCCAGAGGAGCTGGCACGGCGAC
::.:::::::::::::::::::::::::::   ::::::::.::::::::::::::.::::::::.:::::::::::::..::::::::::::::::: :
ACGGTCATTCTGCCTGAGTCTGTCTTCAGA---ACGCCCCCTGTGGTCAGGCCCGCGGGCCCCGGGGAGGCCCAGGAGCTGGAGGAGCTGGCACGGCGTC
-T--V--I--L--P--E--S--V--F--R-----T--P--P--V--V--R--P--A--G--P--G--E--A--Q--E--L--E--E--L--A--R--R--

----------------------------------------------------------------------------------------------------
Q--R--R--H--P--E--L--S--Q--G--E--A--V--A--S--V--I--I--Y--R--T--L--A--G--L--L--P--H--N--Y--D--P--D--K
AGCGACGGCACCCGGAGCTGAGCCAGGGTGAGGCTGTGGCCAGCGTCATCATCTACCGCACCCTGGCCGGGCTACTGCCTCATAACTATGACCCTGACAA
::::.::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.::.:::::.::::: :::::
AGCGGCGGCACCCAGAGCTGAGCCAGGGTGAGGCTGTGGCCAGCGTCATCATCTACCGCACCCTGGCCGGGCTGCTGCCCCACAACTACGACCCGGACAA
Q--R--R--H--P--E--L--S--Q--G--E--A--V--A--S--V--I--I--Y--R--T--L--A--G--L--L--P--H--N--Y--D--P--D--K

--------------><------------------------------------------------------------------------------------
--R--S--L--R--V--P--K--R--P--I--I--N--T--P--V--V--S--I--S--V--H--D--D--E--E--L--L--P--R--A--L--D--K-
GCGCAGCTTGAGAGTCCCCAAACGCCCGATCATCAACACACCCGTGGTGAGCATCAGCGTCCATGATGATGAGGAGCTTCTGCCCCGGGCCCTGGACAAA
:::::::.::   ::.:::::::: :: .::::::::::.::.::::::::::::::.::::::::.::: ::::::::::::::::.::..:::::::.
GCGCAGCCTG---GTTCCCAAACGGCCTGTCATCAACACGCCTGTGGTGAGCATCAGTGTCCATGACGATNAGGAGCTTCTGCCCCGAGCTTTGGACAAG
--R--S--L-----V--P--K--R--P--V--I--N--T--P--V--V--S--I--S--V--H--D--D--X--E--L--L--P--R--A--L--D--K-

----------------------------------------------------------------------------------><----------------
-P--V--T--V--Q--F--R--L--L--E--T--E--E--R--T--K--P--I--C--V--F--W--N--H--S--I--L--V--S--G--T--G--G--
CCCGTCACGGTGCAGTTCCGCCTGCTGGAGACAGAGGAGCGGACCAAGCCCATCTGTGTCTTCTGGAACCATTCAATCCTGGTCAGTGGCACAGGTGGCT
::::::::.::::::::::: :::::::::                                                   :::::.:::::::::::::
CCCGTCACAGTGCAGTTCCGGCTGCTGGAG---------------------------------------------------GTCAGCGGCACAGGTGGCT
-P--V--T--V--Q--F--R--L--L--E-----------------------------------------------------V--S--G--T--G--G--

----------------------------------------------------------------------------------------------------
W--S--A--R--G--C--E--V--V--F--R--N--E--S--H--V--S--C--Q--C--N--H--M--T--S--F--A--V--L--M--D--V--S--R
GGTCGGCCAGAGGCTGTGAAGTCGTCTTCCGCAATGAGAGCCACGTCAGCTGCCAGTGCAACCACATGACGAGCTTCGCTGTGCTCATGGACGTTTCTCG
::::.::: :::::::.:::::.:::::::::::.:::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::: ::.::
GGTCAGCCCGAGGCTGCGAAGTTGTCTTCCGCAACGAGAGCCACGTCAGCTGCCAGTGCAACCACATGACAAGCTTTGCTGTGCTCATGGACGTGTCCCG
W--S--A--R--G--C--E--V--V--F--R--N--E--S--H--V--S--C--Q--C--N--H--M--T--S--F--A--V--L--M--D--V--S--R

---------><-----------------------------------------------------------------------------------------
--R--E--N--G--E--I--L--P--L--K--T--L--T--Y--V--A--L--G--V--T--L--A--A--L--L--L--T--F--F--F--L--T--L-
GCGGGAGAATGGGGAGATCCTGCCACTGAAGACACTGACATACGTGGCTCTAGGTGTCACCTTGGCTGCCCTTCTGCTCACCTTCTTCTTCCTCACTCTC
:::::::::::::::::::::::::::::::::.::::::::::::::.::::: ::::::::::: :::::.::::::::::::.::.:::::::. ::
GCGGGAGAATGGGGAGATCCTGCCACTGAAGACGCTGACATACGTGGCCCTAGGGGTCACCTTGGCGGCCCTCCTGCTCACCTTCCTCCTCCTCACCATC
--R--E--N--G--E--I--L--P--L--K--T--L--T--Y--V--A--L--G--V--T--L--A--A--L--L--L--T--F--L--L--L--T--I-

----------------------------------------------------------------------------------------------------
-L--R--I--L--R--S--N--Q--H--G--I--R--R--N--L--T--A--A--L--G--L--A--Q--L--V--F--L--L--G--I--N--Q--A--
TTGCGTATCCTGCGCTCCAACCAACACGGCATCCGACGTAACCTGACAGCTGCCCTGGGCCTGGCTCAGCTGGTCTTCCTCCTGGGAATCAACCAGGCTG
.:::::..:::::::::::::::.:::::::::::::: :::::::: ::.:::::::::::::::::::::::::::::::::::::::::::::::::
CTGCGTGCCCTGCGCTCCAACCAGCACGGCATCCGACGGAACCTGACTGCCGCCCTGGGCCTGGCTCAGCTGGTCTTCCTCCTGGGAATCAACCAGGCTG
-L--R--A--L--R--S--N--Q--H--G--I--R--R--N--L--T--A--A--L--G--L--A--Q--L--V--F--L--L--G--I--N--Q--A--

----------><----------------------------------------------------------------------------------------
D--L--P--F--A--C--T--V--I--A--I--L--L--H--F--L--Y--L--C--T--F--S--W--A--L--L--E--A--L--H--L--Y--R--A
ACCTCCCTTTTGCCTGCACAGTCATTGCCATCCTGCTGCACTTCCTGTACCTCTGCACCTTTTCCTGGGCTCTGCTGGAGGCCTTGCACCTGTACCGGGC
::::::::::.::.:::::::::::.::::::::::::::::::::::::::::::.:::::::::::::::: :::::::::.::::::::::::::::
ACCTCCCTTTCGCTTGCACAGTCATCGCCATCCTGCTGCACTTCCTGTACCTCTGCGCCTTTTCCTGGGCTCTCCTGGAGGCCCTGCACCTGTACCGGGC
D--L--P--F--A--C--T--V--I--A--I--L--L--H--F--L--Y--L--C--A--F--S--W--A--L--L--E--A--L--H--L--Y--R--A

-------------------------------------------------------------------------------------><-------------
--L--T--E--V--R--D--V--N--T--G--P--M--R--F--Y--Y--M--L--G--W--G--V--P--A--F--I--T--G--L--A--V--G--L-
ACTCACTGAGGTGCGCGATGTCAACACCGGCCCCATGCGCTTCTACTACATGCTGGGCTGGGGCGTGCCTGCCTTCATCACAGGGCTAGCCGTGGGCCTG
.:::::.:::::::::::.::::::.:::::::::::::::::::::::::::::::::::::::::::.::::::::::::   ::.::::::::::::
GCTCACCGAGGTGCGCGACGTCAACGCCGGCCCCATGCGCTTCTACTACATGCTGGGCTGGGGCGTGCCCGCCTTCATCACA---CTGGCCGTGGGCCTG
--L--T--E--V--R--D--V--N--A--G--P--M--R--F--Y--Y--M--L--G--W--G--V--P--A--F--I--T-----L--A--V--G--L-

--------------------------------------------------------------------------------------------------><
-D--P--E--G--Y--G--N--P--D--F--C--W--L--S--I--Y--D--T--L--I--W--S--F--A--G--P--V--A--F--A--V--S--M--
GACCCCGAGGGCTACGGGAACCCTGACTTCTGCTGGCTCTCCATCTATGACACGCTCATCTGGAGTTTTGCTGGCCCGGTGGCCTTTGCCGTCTCGATGA
::::::::::::::.::::::::.::::::::.::::: :::.::::.::.:::::::::::::::::.:::::::: ::::::::::::::::::::::
GACCCCGAGGGCTATGGGAACCCCGACTTCTGTTGGCTGTCCGTCTACGATACGCTCATCTGGAGTTTCGCTGGCCCCGTGGCCTTTGCCGTCTCGATGA
-D--P--E--G--Y--G--N--P--D--F--C--W--L--S--V--Y--D--T--L--I--W--S--F--A--G--P--V--A--F--A--V--S--M--

------------------------------------------------------------------------------><--------------------
S--V--F--L--Y--I--L--A--A--R--A--S--C--A--A--Q--R--Q--G--F--E--K--K--G--P--V--S--G--L--Q--P--S--F--A
GTGTCTTCCTGTACATCCTGGCGGCCCGGGCCTCCTGTGCTGCCCAGCGGCAGGGCTTTGAGAAGAAAGGTCCTGTCTCGGGCCTGCAGCCCTCCTTCGC
:.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::   ::::::::::.::::::::::.:
GCGTCTTCCTGTACATCCTGGCGGCCCGAGCCTCCTGTGCTGCCCAGCGGCAGGGCTTTGAGAAGAAAGGCCCT---TCGGGCCTGCGGCCCTCCTTCAC
S--V--F--L--Y--I--L--A--A--R--A--S--C--A--A--Q--R--Q--G--F--E--K--K--G--P-----S--G--L--R--P--S--F--T

----------------------------------------------------------------------------------------------------
--V--L--L--L--L--S--A--T--W--L--L--A--L--L--S--V--N--S--D--T--L--L--F--H--Y--L--F--A--T--C--N--C--I-
CGTCCTCCTGCTGCTGAGCGCCACGTGGCTGCTGGCACTGCTCTCTGTCAACAGCGACACCCTCCTCTTCCACTACCTCTTTGCTACCTGCAATTGCATC
.:::::::::::::::::::::.:::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::.:.::::::::::::
TGTCCTCCTGCTGCTGAGCGCCGCGTGGCTGCTGGCACTGCTCTCTGTCAACAGTGACACCCTCCTCTTCCACTACCTCTTTGCTGCTTGCAATTGCATC
--V--L--L--L--L--S--A--A--W--L--L--A--L--L--S--V--N--S--D--T--L--L--F--H--Y--L--F--A--A--C--N--C--I-

-----><---------------------------------------------------------------------------------------------
-Q--G--P--F--I--F--L--S--Y--V--V--L--S--K--E--V--R--K--A--L--K--L--A--C--S--R--K--P--S--P--D--P--A--
CAGGGCCCCTTCATCTTCCTCTCCTATGTGGTGCTTAGCAAGGAGGTCCGGAAAGCACTCAAGCTTGCCTGCAGCCGCAAGCCCAGCCCTGACCCTGCTC
::::::::::::::::::::::::::.::::::::.:::::::::::::::::.::.::::::.:..:::::::::::::::::::::: ::::::::::
CAGGGCCCCTTCATCTTCCTCTCCTACGTGGTGCTCAGCAAGGAGGTCCGGAAGGCGCTCAAGTTCACCTGCAGCCGCAAGCCCAGCCCGGACCCTGCTC
-Q--G--P--F--I--F--L--S--Y--V--V--L--S--K--E--V--R--K--A--L--K--F--T--C--S--R--K--P--S--P--D--P--A--

----------------------------><----------------------------------------------------------------------
L--T--T--K--S--T--L--T--S--S--Y--N--C--P--S--P--Y--A--D--G--R--L--Y--Q--P--Y--G--D--S--A--G--S--L--H
TGACCACCAAGTCCACCCTGACCTCGTCCTACAACTGCCCCAGCCCCTACGCAGATGGGCGGCTGTACCAGCCCTACGGAGACTCGGCCGGCTCTCTGCA
:::: :::::::::::::::::::::::::::::::::::::::::.::.::.::.::. :::::::.::::::::::::::.::.::.:::::::::::
TGACGACCAAGTCCACCCTGACCTCGTCCTACAACTGCCCCAGCCCTTATGCGGACGGAAGGCTGTATCAGCCCTACGGAGATTCAGCTGGCTCTCTGCA
L--T--T--K--S--T--L--T--S--S--Y--N--C--P--S--P--Y--A--D--G--R--L--Y--Q--P--Y--G--D--S--A--G--S--L--H

--------------------------------------------------------><------------------------------------------
--S--T--S--R--S--G--K--S--Q--P--S--Y--I--P--F--L--L--R--E--E--S--A--L--N--P--G--Q--G--P--P--G--L--G-
CAGCACCAGTCGCTCGGGCAAGAGTCAGCCCAGCTACATCCCCTTCTTGCTGAGGGAGGAGTCCGCACTGAACCCTGGCCAAGGGCCCCCTGGCCTGGGG
:::..::::.::::: ::::::::::::::::::::::::::::::::::::   ::.::::::.:::::::::::::.::.::::::::::::::::::
CAGTGCCAGCCGCTCCGGCAAGAGTCAGCCCAGCTACATCCCCTTCTTGCTG---GAAGAGTCCACACTGAACCCTGGTCAGGGGCCCCCTGGCCTGGGG
--S--A--S--R--S--G--K--S--Q--P--S--Y--I--P--F--L--L-----E--E--S--T--L--N--P--G--Q--G--P--P--G--L--G-

---------------------------------------------><-----------------------------------------------------
-D--P--G--S--L--F--L--E--G--Q--D--Q--Q--H--D--P--D--T--D--S--D--S--D--L--S--L--E--D--D--Q--S--G--S--
GATCCAGGCAGCCTGTTCCTGGAAGGTCAAGACCAGCAGCATGATCCTGACACGGACTCCGACAGTGACCTGTCCTTAGAAGACGACCAGAGTGGCTCCT
::.::.:: :::::::::::::::::::::::::::::::::   ::.:::::::::::.:::::::::::::::.:.:::::.::::::::::::::::
GACCCGGGGAGCCTGTTCCTGGAAGGTCAAGACCAGCAGCAT---CCCGACACGGACTCTGACAGTGACCTGTCCCTGGAAGATGACCAGAGTGGCTCCT
-D--P--G--S--L--F--L--E--G--Q--D--Q--Q--H-----P--D--T--D--S--D--S--D--L--S--L--E--D--D--Q--S--G--S--

----------------------------------------------------------------------------------------------------
Y--A--S--T--H--S--S--D--S--E--E--E--E--E--E--E--E--E--E--A--A--F--P--G--E--Q--G--W--D--S--L--L--G--P
ATGCCTCTACCCACTCATCAGACAGTGAGGAGGAAGAAGAGGAGGAGGAAGAGGAGGCCGCCTTCCCTGGAGAGCAGGGCTGGGATAGCCTGCTGGGGCC
::::::::::::::::.::::::::.            :::::::::::. .:::::::::::::::::::::.: .::::::::.::::::::::::::
ATGCCTCTACCCACTCGTCAGACAGC------------GAGGAGGAGGAGCGGGAGGCCGCCTTCCCTGGAGAACCAGGCTGGGACAGCCTGCTGGGGCC
Y--A--S--T--H--S--S--D--S--------------E--E--E--E--R--E--A--A--F--P--G--E--P--G--W--D--S--L--L--G--P

----------------------------------------><----------------------------------------------------------
--G--A--E--R--L--P--L--H--S--T--P--K--D--G--G--P--G--P--G--K--A--P--W--P--G--D--F--G--T--T--A--K--E-
TGGAGCAGAGAGACTGCCCCTGCACAGTACTCCCAAGGATGGGGGCCCAGGGCCTGGCAAGGCCCCCTGGCCAGGAGACTTTGGGACCACAGCAAAAGAG
:::.:: :::::.::::::::::::::.::.::::::   :::::::..:::::.:: ::::.::::::::::::::::::::::::: :::::::.:::
TGGGGCCGAGAGGCTGCCCCTGCACAGCACCCCCAAG---GGGGGCCTGGGGCCCGGAAAGGTCCCCTGGCCAGGAGACTTTGGGACCCCAGCAAAGGAG
--G--A--E--R--L--P--L--H--S--T--P--K-----G--G--L--G--P--G--K--V--P--W--P--G--D--F--G--T--P--A--K--E-

----------------------------------------------------------------------------------------------------
-S--S--G--N--G--A--P--E--E--R--L--R--E--N--G--D--A--L--S--R--E--G--S--L--G--P--L--P--G--S--S--A--Q--
AGTAGTGGCAACGGGGCCCCTGAGGAGCGGCTGCGGGAGAATGGAGATGCCCTGTCTCGAGAGGGGTCCCTAGGCCCCCTTCCAGGCTCTTCTGCCCAGC
.::.:::: ::.:::.:..::::                                                                             
GGTGGTGGGAATGGGACTTCTGAC----------------------------------------------------------------------------
-G--G--G--N--G--T--S--D-----------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
P--H--K--G--I--L--K--K--K--C--L--P--T--I--S--E--K--S--S--L--L--R--L--P--L--E--Q--C--T--G--S--S--R--G
CTCACAAAGGCATCCTTAAGAAGAAGTGTCTGCCCACCATCAGCGAGAAGAGCAGCCTCCTGCGGCTCCCCCTGGAGCAATGCACAGGGTCTTCCCGGGG
           :::::.:::::::::::::::::::::::::::::::::::::::::::: ::.:: :::::::::::. ::::::::::.::::::::
-----------ATCCTCAAGAAGAAGTGTCTGCCCACCATCAGCGAGAAGAGCAGCCTCCTCCGACTGCCCCTGGAGCAGGGCACAGGGTCCTCCCGGGG
------------I--L--K--K--K--C--L--P--T--I--S--E--K--S--S--L--L--R--L--P--L--E--Q--G--T--G--S--S--R--G

----------------------------------------------------------------------------------------------------
--S--S--A--S--E--G--S--R--G--G--P--P--P--R--P--P--P--R--Q--S--L--Q--E--Q--L--N--G--V--M--P--I--A--M-
CTCCTCCGCTAGTGAGGGCAGCCGGGGAGGCCCCCCTCCCCGCCCACCGCCCCGGCAGAGCCTCCAGGAGCAGCTGAACGGGGTCATGCCCATCGCCATG
:::::::::.::.:::::::::::::  :: :::::::: :: :: :::::::::::::::::::::::::::::::::::::::::::::::.::::::
CTCCTCCGCCAGCGAGGGCAGCCGGGCCGGGCCCCCTCCACGGCCCCCGCCCCGGCAGAGCCTCCAGGAGCAGCTGAACGGGGTCATGCCCATTGCCATG
--S--S--A--S--E--G--S--R--A--G--P--P--P--R--P--P--P--R--Q--S--L--Q--E--Q--L--N--G--V--M--P--I--A--M-

----------------------------------------------><------------------------
-S--I--K--A--G--T--V--D--E--D--S--S--G--S--E--F--L--F--F--N--F--L--H--*-
AGCATCAAGGCAGGCACGGTGGATGAGGACTCGTCAGGCTCCGAATTTCTCTTCTTTAACTTCCTGCATTAA
:::::::::::::::::::::::.:::::::::::.::::::                              
AGCATCAAGGCAGGCACGGTGGACGAGGACTCGTCGGGCTCC------------------------------
-S--I--K--A--G--T--V--D--E--D--S--S--G--S-------------------------------

Pig Consensus Sequence

>BGISUST0000898081
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------TCTGATGGCACACGGCAGGACACCGCCCAAGTGGTGGTG
AATGTCACTGACGCCAATACGCATCGTCCCGTGTTTCAGAGCTCCCACTACACGGTGAATGTTAACGAGGACCGGCCAGCAGGCACCACAGTGGTGCTGA
TCAGTGCCACAGACGAGGACACCGGTGAGAACGCCCGCATCACCTACTTTATGGAGGACAGCATCCCCCAGTTCCGCATCGATGCAGACACGGGGGCTGT
CACCACCCAAGCCGAGCTGGACTACGAGGACCAGGTGTCCTACACCCTGGCCATCACCGCCCGGGACAACGGTATCCCCCAGAAGTCTGACACCACCTAC
CTGGAGATCCTGGTGAACGACGTGAATGACAACGCTCCTCAGTTCCTGCGGGACTCCTACCAGGGCAGCGTCTACGAGGATGTGCCCCCCTTCACCAGCG
TCCTGCAGATCTCAGCCACTGACCGTGACTCTGGTCTTAACGGCAGGGTCTTCTACACCTTCCAAGGTGGCGATGATGGAGATGGAGACTTTATCGTAGA
GTCCACATCAGGCATCGTGCGCACGCTGCGGAGGCTGGATCGTGAAAATGTGGCCCAGTACATCCTGCGGGCGTATGCAGTGGACAAGGGGATGCCTCCA
GCCCGCACGCCCATGGAGGTGACGGTCACTGTGTTGGATGTGAATGACAATCCGCCCGTCTTTGAGCAGGATGAGTTTGATGTGTTTGTGGAAGAGAACA
GTCCCATTGGGCTGGCTGTGGCCCGGGTCACAGCCACTGACCCTGACGAGGGCACCAACGCCCAGATCATGTACCAGATTGTGGAGGGCAACATCCCTGA
GGTCTTCCAGCTGGACATCTTCTCTGGGGAGCTGACCGCCCTGGTAGACTTGGAC---------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---TCGGAGGACCTGCAGGAGCGCCTGTACCTCAACCGCAGCCTGCTGACGGCCATCTCCGCGCAGCGCGTGCTGCCCTTCGACGACAACATCTGCCTGC
GCGAGCCCTGCGAGAACTACATGCGCTGCGTGTCGGTCCTGCGCTTCGACTCCTCGGCGCCCTTCATCTCCTCCTCCTCCGTGCTCTTCCGGCCCATCCA
CCCGGTCGGGGGGCTGCGCTGCCGCTGCCCGCCAGGCTTCACCGGTGACTACTGCGAGACGGAGGTGGACCTCTGCTACTCGCGGCCCTGCGCCCCCCAC
GGGCGCTGCCGCAGCCGTGAGGGCGGCTACACCTGCCTCTGCCGAGAGGGCTACACG-------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------TACAACGGGCGCTTCAACGAGAAGCATGACTTTGTGGCCCTCGAGGTGATCCAGGAGCAGGTCCAGCTCACCTTCTCTGCA---G
AGTCGACCACCACTGTGTCCCCATTCGTGCCCGGAGGGGTCAGTGACGGCCAGTGGCACACGGTGCAGCTGAAGTACTACAATAAG--------------
----------------------------------------------------------------------------------------------------
---------------------------------------------TCTCTGGACCTGACGGGGCCCCTGCTGCTGGGCGGGGTCCCTGACCTGCCCGAGA
GCTTCCCTGTCCGCACGCGGCACTTCGTGGGCTGCATGAGGAACCTGCAGGTGGATAGCCGACACGTCGACATGGCCGACTTCATTGCCAACAATGGCAC
CGTGCCT---TGCCCTGCCAAGAAGAATGTGTGCGACAGCAACACCTGCCACAATGGGGGCACCTGTGTGAACCAGTGGGATGCGTTCAGCTGCCAGTGC
CCTCTGGGcgGGGGCAAGAGCTGTGCCCAG---------AACCCGCAGCGCTTCCTGGGCAGCAGCTTGGTGGCCTGGCACGGCCTCTCACTGCCCATCT
CCCAGCCCTGGCACCTCAGCCTCATGTTCCGTACGCGCCAGGCCGACGGCGTCCTACTGCAGGCTGTCACGAGGGGGCGCAGCACTATCACCCTGCAG--
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------TACTATGGTGACAACTGCACTAACGTGTGTGACCTGA
ACCCATGTGAGCATCACTCCATATGTACCCGAAAGCCCAGTGCCCCCCATGGCTATACCTGCGAGTGTCCCCAAAATTACCTTGGGCCATACTGTGAGAC
C---ATTGACCAGCCTTGCCCCCGAGGCTGGTGGGGACACCCCACCTGCGGCCCATGCAACTGTGACGTCAGCAAAGGCTTCGATCCAGACTGCAACAAG
ACGAGCGGCGAGTGCCACTGCAAGGAGAACCACTACCGGCCCCCTGGCAGCCCCTCCTGCCTCCTGTGTGACTGCTACCCCACGGGCTCTCTGTCCCGAG
TCTGTGACCCCGAGGATGGCCAGTGTCCATGCAAGCCAGGTGTCATTGGGCGTCAGTGTGACCGCTGTGACAACCCTTTTGCTGAGGTTACCACCAACGG
CTGTGAA---AATTACGACAGCTGCCCCCGAGCTATTGAGGCGGGAATCTGGTGGCCCCGTACCCGCTTTGGGCTGCCTGCTGCTGCCCCCTGCCCCAAA
GGCTCCTTT---ACCGCTGTGCGCCACTGTGACGAGCACCGAGGGTGGCTCCCGCCAAACCTCTTCAACTGCACGTCCGTCACCTTCTCGGAGCTGAAGG
GC---GCTGAGCGGCTGCAGCGAAATGAGTCAGGCCTGGACTCGGGGCGCTCCCAGCGGCTGGCCCTGCTTCTGCGCAACGCTACCCAGCACACAGCTGG
CTACTTCGGCAGCGATGTCAAGGTGGCCTACCAGCTGGCCACAAGGCTACTAGCCCACGAGAGCGCCCAGCGGGGCTTCGGGCTGTCCGCCACGCAGGAT
GTGCACTTCACTGAGAATCTGCTGCGGGTGGGCAGCGCCCTCCTGGATGCAGCCAACAAGCGGCACTGGGAGCTGATCCAGCAGACGGAGGGGGGCACTG
CCTGGCTGCTGCAGCACTACGAGGCCTACGCCAGCGCCCTGGCCCAGAACATGCGGCACACCTACCTCAGCCCCTTCACCATCGTCACGCCCAACATT--
-ATCTCTGTGGTTCGCTTGGACAAGGGGAACTTCGCGGGGGCCAAGCTGCCCCGTTACGAGGCGCTGCGGGGGGAGCGGCCCCCGGACCTTGAGACAACG
GTCATTCTGCCTGAGTCTGTCTTCAGA---ACGCCCCCTGTGGTCAGGCCCGCGGGCCCCGGGGAGGCCCAGGAGCTGGAGGAGCTGGCACGGCGTCAGC
GGCGGCACCCAGAGCTGAGCCAGGGTGAGGCTGTGGCCAGCGTCATCATCTACCGCACCCTGGCCGGGCTGCTGCCCCACAACTACGACCCGGACAAGCG
CAGCCTG---GTTCCCAAACGGCCTGTCATCAACACGCCTGTGGTGAGCATCAGTGTCCATGACGATNAGGAGCTTCTGCCCCGAGCTTTGGACAAGCCC
GTCACAGTGCAGTTCCGGCTGCTGGAG---------------------------------------------------GTCAGCGGCACAGGTGGCTGGT
CAGCCCGAGGCTGCGAAGTTGTCTTCCGCAACGAGAGCCACGTCAGCTGCCAGTGCAACCACATGACAAGCTTTGCTGTGCTCATGGACGTGTCCCGGCG
GGAGAATGGGGAGATCCTGCCACTGAAGACGCTGACATACGTGGCCCTAGGGGTCACCTTGGCGGCCCTCCTGCTCACCTTCCTCCTCCTCACCATCCTG
CGTGCCCTGCGCTCCAACCAGCACGGCATCCGACGGAACCTGACTGCCGCCCTGGGCCTGGCTCAGCTGGTCTTCCTCCTGGGAATCAACCAGGCTGACC
TCCCTTTCGCTTGCACAGTCATCGCCATCCTGCTGCACTTCCTGTACCTCTGCGCCTTTTCCTGGGCTCTCCTGGAGGCCCTGCACCTGTACCGGGCGCT
CACCGAGGTGCGCGACGTCAACGCCGGCCCCATGCGCTTCTACTACATGCTGGGCTGGGGCGTGCCCGCCTTCATCACA---CTGGCCGTGGGCCTGGAC
CCCGAGGGCTATGGGAACCCCGACTTCTGTTGGCTGTCCGTCTACGATACGCTCATCTGGAGTTTCGCTGGCCCCGTGGCCTTTGCCGTCTCGATGAGCG
TCTTCCTGTACATCCTGGCGGCCCGAGCCTCCTGTGCTGCCCAGCGGCAGGGCTTTGAGAAGAAAGGCCCT---TCGGGCCTGCGGCCCTCCTTCACTGT
CCTCCTGCTGCTGAGCGCCGCGTGGCTGCTGGCACTGCTCTCTGTCAACAGTGACACCCTCCTCTTCCACTACCTCTTTGCTGCTTGCAATTGCATCCAG
GGCCCCTTCATCTTCCTCTCCTACGTGGTGCTCAGCAAGGAGGTCCGGAAGGCGCTCAAGTTCACCTGCAGCCGCAAGCCCAGCCCGGACCCTGCTCTGA
CGACCAAGTCCACCCTGACCTCGTCCTACAACTGCCCCAGCCCTTATGCGGACGGAAGGCTGTATCAGCCCTACGGAGATTCAGCTGGCTCTCTGCACAG
TGCCAGCCGCTCCGGCAAGAGTCAGCCCAGCTACATCCCCTTCTTGCTG---GAAGAGTCCACACTGAACCCTGGTCAGGGGCCCCCTGGCCTGGGGGAC
CCGGGGAGCCTGTTCCTGGAAGGTCAAGACCAGCAGCAT---CCCGACACGGACTCTGACAGTGACCTGTCCCTGGAAGATGACCAGAGTGGCTCCTATG
CCTCTACCCACTCGTCAGACAGCGAGGAGGAGGAGCGGGAGGCCGCCTTCCCTGGAGAACCAGGCTGGGACAGCCTGCTGGGGCCTGGGGCCGAGAGGCT
GCCCCTGCACAGCACCCCCAAG---GGGGGCCTGGGGCCCGGAAAGGTCCCCTGGCCAGGAGACTTTGGGACCCCAGCAAAGGAGGGTGGTGGGAATGGG
ACTTCTGAC---------------------------------------------------------------------------------------ATCC
TCAAGAAGAAGTGTCTGCCCACCATCAGCGAGAAGAGCAGCCTCCTCCGACTGCCCCTGGAGCAGGGCACAGGGTCCTCCCGGGGCTCCTCCGCCAGCGA
GGGCAGCCGGGCCGGGCCCCCTCCACGGCCCCCGCCCCGGCAGAGCCTCCAGGAGCAGCTGAACGGGGTCATGCCCATTGCCATGAGCATCAAGGCAGGC
ACGGTGGACGAGGACTCGTCGGGCTCC------------------------------


>BGISUSP0000898081
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------SDGTRQDTAQVVV
NVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTY
LEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYILRAYAVDKGMPP
ARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVDLD---------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-SEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFISSSSVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCAPH
GRCRSREGGYTCLCREGYT---------------------------------------------------------------------------------
-----YNGRFNEKHDFVALEVIQEQVQLTFSA-ESTTTVSPFVPGGVSDGQWHTVQLKYYNK--------------------------------------
---------------SLDLTGPLLLGGVPDLPESFPVRTRHFVGCMRNLQVDSRHVDMADFIANNGTVP-CPAKKNVCDSNTCHNGGTCVNQWDAFSCQC
PLGGGKSCAQ---NPQRFLGSSLVAWHGLSLPISQPWHLSLMFRTRQADGVLLQAVTRGRSTITLQ----------------------------------
----------------------------------------------------------------------------------------------------
---------------------YYGDNCTNVCDLNPCEHHSICTRKPSAPHGYTCECPQNYLGPYCET-IDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNK
TSGECHCKENHYRPPGSPSCLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCE-NYDSCPRAIEAGIWWPRTRFGLPAAAPCPK
GSF-TAVRHCDEHRGWLPPNLFNCTSVTFSELKG-AERLQRNESGLDSGRSQRLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESAQRGFGLSATQD
VHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNI-ISVVRLDKGNFAGAKLPRYEALRGERPPDLETT
VILPESVFR-TPPVVRPAGPGEAQELEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSL-VPKRPVINTPVVSISVHDD-ELLPRALDKP
VTVQFRLLE-----------------VSGTGGWSARGCEVVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLTFLLLTIL
RALRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCAFSWALLEALHLYRALTEVRDVNAGPMRFYYMLGWGVPAFIT-LAVGLD
PEGYGNPDFCWLSVYDTLIWSFAGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGP-SGLRPSFTVLLLLSAAWLLALLSVNSDTLLFHYLFAACNCIQ
GPFIFLSYVVLSKEVRKALKFTCSRKPSPDPALTTKSTLTSSYNCPSPYADGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLL-EESTLNPGQGPPGLGD
PGSLFLEGQDQQH-PDTDSDSDLSLEDDQSGSYASTHSSDSEEEEREAAFPGEPGWDSLLGPGAERLPLHSTPK-GGLGPGKVPWPGDFGTPAKEGGGNG
TSD-----------------------------ILKKKCLPTISEKSSLLRLPLEQGTGSSRGSSASEGSRAGPPPRPPPRQSLQEQLNGVMPIAMSIKAG
TVDEDSSGS----------