Sequences
EST Library Info
fhi1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000143157 (click for geneview)
Transcript ID ENST00000271372(link to ensembl)
Symbol POGK
Localtion Chromosome:1:163540382:163557239:1 band: 1q24.1
Description Pogo transposable element with KRAB domain (LST003/SLTP003).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--S--T--A--Y--P--L--N--L--S--L--K--E--E--E--E--E--E--E--I--Q--S--R--E--L--E--D--G--P--A--D--M--
ATGGAGTCCACAGCCTACCCTCTCAATTTGAGCCTGAAAGAAGAGGAAGAGGAAGAAGAGATTCAGAGCCGGGAACTAGAGGACGGCCCGGCAGACATGC
:::::.:::::::::::::::::::  :: . ::::::.::::::::: :.:::::::::::: .::::::::::::.:::::.::.::  ::::.::::
ATGGAATCCACAGCCTACCCTCTCAT-TTCGTCCTGAAGGAAGAGGAACAAGAAGAAGAGATTAGGAGCCGGGAACTGGAGGATGGTCCCCCAGATATGC
-M--E--S--T--A--Y--P--L--N--F--V--L--K--E--E--E--Q--E--E--E--I--R--S--R--E--L--E--D--G--P--P--D--M--

----------------------------------><----------------------------------------------------------------
Q--K--V--R--I--C--S--E--G--G--W--V--P--A--L--F--D--E--V--A--I--Y--F--S--D--E--E--W--E--V--L--T--E--Q
AGAAAGTACGAATCTGCTCTGAGGGCGGATGGGTACCGGCCCTATTTGATGAGGTGGCCATATATTTTTCCGATGAGGAATGGGAAGTTTTGACGGAGCA
::::.:: ::::::::::: ::::::::::::::.::::::::.::.::::::::::::::::::::.::.::::::::.::::::::::::::::::::
AGAAGGTCCGAATCTGCTCAGAGGGCGGATGGGTGCCGGCCCTGTTCGATGAGGTGGCCATATATTTCTCTGATGAGGAGTGGGAAGTTTTGACGGAGCA
Q--K--V--R--I--C--S--E--G--G--W--V--P--A--L--F--D--E--V--A--I--Y--F--S--D--E--E--W--E--V--L--T--E--Q

-------------------------------------------------------------><-------------------------------------
--Q--K--A--L--Y--R--E--V--M--R--M--N--Y--E--T--V--L--S--L--E--F--P--F--P--K--P--D--M--I--T--R--L--E-
ACAAAAGGCCCTCTACCGGGAAGTCATGAGGATGAATTATGAAACTGTCCTGTCCCTGGAATTCCCATTCCCTAAGCCAGACATGATCACCCGTTTGGAA
:::::::::::::::::::::.::::::::::::::::::::::::::::::::::::   ::::::::::::::::: :::::::::::.:: ::::::
ACAAAAGGCCCTCTACCGGGAGGTCATGAGGATGAATTATGAAACTGTCCTGTCCCTG---TTCCCATTCCCTAAGCCCGACATGATCACTCGGTTGGAA
--Q--K--A--L--Y--R--E--V--M--R--M--N--Y--E--T--V--L--S--L-----F--P--F--P--K--P--D--M--I--T--R--L--E-

------------------------------------------------------------><--------------------------------------
-G--E--E--E--S--Q--N--S--D--E--W--Q--L--Q--G--G--T--S--A--E--N--E--E--S--D--V--K--P--P--D--W--P--N--
GGGGAGGAGGAGTCTCAGAATTCTGACGAGTGGCAGCTCCAAGGAGGCACCTCTGCAGAAAATGAAGAATCTGACGTAAAGCCTCCAGACTGGCCAAACC
:::::::::::::::                                                                                     
GGGGAGGAGGAGTCT-------------------------------------------------------------------------------------
-G--E--E--E--S--------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--M--N--A--T--S--Q--F--P--Q--P--Q--H--F--D--S--F--G--L--R--L--P--R--D--I--T--E--L--P--E--W--S--E--G
CAATGAATGCTACCTCCCAGTTTCCTCAGCCTCAGCACTTTGACAGCTTTGGCCTCCGTCTGCCTCGGGATATCACAGAGCTGCCCGAGTGGAGTGAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Y--P--F--Y--M--A--M--G--F--P--G--Y--D--L--S--A--D--D--I--A--G--K--F--Q--F--S--R--G--M--R--R--S--Y-
GTACCCCTTCTACATGGCCATGGGCTTCCCAGGGTATGACCTCTCGGCTGATGACATAGCTGGGAAGTTTCAGTTCAGCCGGGGCATGCGCCGCAGTTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--A--G--F--K--L--M--V--V--E--Y--A--E--S--T--N--N--C--Q--A--A--K--Q--F--G--V--L--E--K--N--V--R--D--
GACGCAGGGTTCAAGCTGATGGTAGTGGAATATGCTGAGAGTACCAACAACTGCCAGGCTGCCAAGCAGTTTGGAGTATTGGAAAAAAACGTTCGAGACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
W--R--K--V--K--P--Q--L--Q--N--A--H--A--M--R--R--A--F--R--G--P--K--N--G--R--F--A--L--V--D--Q--R--V--A
GGCGCAAAGTGAAGCCACAGCTTCAAAACGCCCACGCCATGCGGCGGGCATTCCGAGGCCCCAAGAATGGGAGGTTTGCTCTGGTGGACCAGCGTGTGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--Y--V--R--Y--M--Q--A--K--G--D--P--I--T--R--E--A--M--Q--L--K--A--L--E--I--A--Q--E--M--N--I--P--E-
CGAATATGTCAGATACATGCAGGCCAAAGGGGACCCCATCACCCGGGAGGCGATGCAGCTGAAAGCTCTCGAAATCGCCCAGGAAATGAACATTCCAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--G--F--K--A--S--L--G--W--C--R--R--M--M--R--R--Y--D--L--S--L--R--H--K--V--P--V--P--Q--H--L--P--E--
AAAGGGTTCAAGGCAAGCTTGGGTTGGTGTCGAAGAATGATGAGAAGGTATGACCTGTCTCTGAGGCATAAAGTGCCCGTGCCCCAGCACCTGCCGGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--L--T--E--K--L--V--T--Y--Q--R--S--V--L--A--L--R--R--A--H--D--Y--E--V--A--Q--M--G--N--A--D--E--T--P
ACCTGACTGAGAAACTCGTCACTTACCAGCGCAGTGTCCTGGCTCTGCGCAGGGCGCATGACTATGAGGTAGCTCAGATGGGGAATGCAGATGAGACGCC
              ::.:::::.:::::::: :::::::::::.::::: :::::.::.:::::. ::::.:::::::::::.::::::::.::::::::
--------------CTTGTCACCTACCAGCGAAGTGTCCTGGCCCTGCGAAGGGCACACGACTACCAGGTGGCTCAGATGGGAAATGCAGACGAGACGCC
---------------L--V--T--Y--Q--R--S--V--L--A--L--R--R--A--H--D--Y--Q--V--A--Q--M--G--N--A--D--E--T--P

----------------------------------------------------------------------------------------------------
--I--C--L--E--V--P--S--R--V--T--V--D--N--Q--G--E--K--P--V--L--V--K--T--P--G--R--E--K--L--K--I--T--A-
CATTTGTTTAGAGGTGCCATCACGGGTAACTGTTGATAACCAGGGCGAAAAGCCTGTCTTGGTCAAGACACCAGGCAGGGAAAAACTGAAAATCACAGCA
::::::.::.:::::::: ::: ::::.::::: ::.::::::::.:::::::: ::::::::::::::.:::::::::::.::::::::::::::.:: 
CATTTGCTTGGAGGTGCCCTCAAGGGTGACTGTGGACAACCAGGGTGAAAAGCCGGTCTTGGTCAAGACGCCAGGCAGGGAGAAACTGAAAATCACGGCT
--I--C--L--E--V--P--S--R--V--T--V--D--N--Q--G--E--K--P--V--L--V--K--T--P--G--R--E--K--L--K--I--T--A-

----------------------------------------------------------------------------------------------------
-M--L--G--V--L--A--D--G--R--K--L--P--P--Y--I--I--L--R--G--T--Y--I--P--P--G--K--F--P--S--G--M--E--I--
ATGCTTGGTGTCTTGGCTGATGGGAGGAAGTTACCACCGTACATCATTTTGAGGGGAACATATATCCCCCCGGGGAAGTTTCCCAGTGGGATGGAAATTC
::::::::.:::.:::::::::::::::::::::: ::::::::::::.::::::: ::.::.:::::::: ::::::::.:::::::: ::::::::.:
ATGCTTGGCGTCCTGGCTGATGGGAGGAAGTTACCTCCGTACATCATTCTGAGGGGTACGTACATCCCCCCCGGGAAGTTCCCCAGTGGCATGGAAATCC
-M--L--G--V--L--A--D--G--R--K--L--P--P--Y--I--I--L--R--G--T--Y--I--P--P--G--K--F--P--S--G--M--E--I--

----------------------------------------------------------------------------------------------------
R--C--H--R--Y--G--W--M--T--E--D--L--M--Q--D--W--L--E--V--V--W--R--R--R--T--G--A--V--P--K--Q--R--G--M
GCTGCCACCGGTATGGGTGGATGACTGAAGACTTGATGCAGGACTGGTTGGAAGTGGTGTGGAGACGGAGGACAGGAGCAGTGCCCAAGCAGCGAGGGAT
:::::::::::::.::.:::::::: ::.:::::::::::::::::::::::::::::::::::.:::::::: :: :: ::::::::::::::.:::::
GCTGCCACCGGTACGGATGGATGACAGAGGACTTGATGCAGGACTGGTTGGAAGTGGTGTGGAGGCGGAGGACTGGCGCCGTGCCCAAGCAGCGGGGGAT
R--C--H--R--Y--G--W--M--T--E--D--L--M--Q--D--W--L--E--V--V--W--R--R--R--T--G--A--V--P--K--Q--R--G--M

----------------------------------------------------------------------------------------------------
--L--I--L--N--G--F--R--G--H--A--T--D--S--V--K--N--S--M--E--S--M--N--T--D--M--V--I--I--P--G--G--L--T-
GCTGATCTTGAATGGCTTCCGGGGCCATGCCACAGATTCCGTGAAGAACTCCATGGAAAGCATGAACACTGACATGGTGATCATCCCAGGGGGTCTGACC
:::::::.::::.:::::::::::.::.:::::.::::: :::::::.:::::::::::::::::::::::::::::: ::::::::.:::::.::::::
GCTGATCCTGAACGGCTTCCGGGGTCACGCCACGGATTCGGTGAAGAGCTCCATGGAAAGCATGAACACTGACATGGTCATCATCCCGGGGGGCCTGACC
--L--I--L--N--G--F--R--G--H--A--T--D--S--V--K--S--S--M--E--S--M--N--T--D--M--V--I--I--P--G--G--L--T-

----------------------------------------------------------------------------------------------------
-S--Q--L--Q--V--L--D--V--V--V--Y--K--P--L--N--D--S--V--R--A--Q--Y--S--N--W--L--L--A--G--N--L--A--L--
TCACAGCTTCAGGTGCTGGATGTCGTGGTCTACAAGCCACTGAATGACAGTGTGCGGGCCCAGTACTCCAACTGGCTTCTGGCTGGGAACCTGGCGCTGA
::.::::: ::::::.:.::::: :::::::::::.::.:::::::::::::: ::::: :::::::::::.::::::::::: ::.:::::::::::::
TCGCAGCTGCAGGTGTTAGATGTGGTGGTCTACAAACCGCTGAATGACAGTGTCCGGGCGCAGTACTCCAATTGGCTTCTGGCGGGAAACCTGGCGCTGA
-S--Q--L--Q--V--L--D--V--V--V--Y--K--P--L--N--D--S--V--R--A--Q--Y--S--N--W--L--L--A--G--N--L--A--L--

----------------------------------------------------------------------------------------------------
S--P--T--G--N--A--K--K--P--P--L-----G--L--F--L--E--W--V--M--V--A--W--N--S--I--S--S--E--S--I--V--Q--G
GCCCAACCGGGAATGCTAAGAAGCCACCCCTG---GGCCTCTTTCTGGAGTGGGTCATGGTCGCGTGGAATAGCATCTCAAGTGAGTCCATCGTCCAAGG
:::: ::.:::::.::.::::::::.:::::     ::::::::::::::::::::::::: ::::::::.::::::::::::::.:::::.::::::::
GCCCCACTGGGAACGCCAAGAAGCCGCCCCTTG--TGCCTCTTTCTGGAGTGGGTCATGGTAGCGTGGAACAGCATCTCAAGTGAATCCATTGTCCAAGG
S--P--T--G--N--A--K--K--P--P--L--\--G--L--F--L--E--W--V--M--V--A--W--N--S--I--S--S--E--S--I--V--Q--G

----------------------------------------------------------------------------------------------------
--F--K--K--C--H--I--S--S--N--L--E--E--E--D--D--V--L--W--E--I--E--S--E--L--P--G--G--G--E--P--P--K--D-
GTTCAAGAAGTGCCATATCTCCAGCAACTTGGAGGAGGAAGACGATGTCCTGTGGGAAATCGAGAGTGAGTTGCCAGGAGGAGGAGAACCACCAAAAGAT
:::::::::::::::.:::::::::::::::::.:: :::::.::.:::::.::::::::.:::::.:::::::::::::::::.::.::::: ::::: 
GTTCAAGAAGTGCCACATCTCCAGCAACTTGGAAGATGAAGATGACGTCCTATGGGAAATTGAGAGCGAGTTGCCAGGAGGAGGGGAGCCACCCAAAGAG
--F--K--K--C--H--I--S--S--N--L--E--D--E--D--D--V--L--W--E--I--E--S--E--L--P--G--G--G--E--P--P--K--E-

---------------------------------
-C--D--T--E--S--M--A--E--S--N--*-
TGTGACACCGAAAGCATGGCTGAGAGCAACTGA
:::::::: ::.::: ::.: ::::::::::::
TGTGACACGGAGAGCCTGACAGAGAGCAACTGA
-C--D--T--E--S--L--T--E--S--N--*-

Pig Consensus Sequence

>BGISUST0000877798
ATGGAATCCACAGCCTACCCTCTctTCGTCCTGAAGGAAGAGGAACAAGAAGAAGAGATTAGGAGCCGGGAACTGGAGGATGGTCCCCCAGATATGCAGA
AGGTCCGAATCTGCTCAGAGGGCGGATGGGTGCCGGCCCTGTTCGATGAGGTGGCCATATATTTCTCTGATGAGGAGTGGGAAGTTTTGACGGAGCAACA
AAAGGCCCTCTACCGGGAGGTCATGAGGATGAATTATGAAACTGTCCTGTCCCTG---TTCCCATTCCCTAAGCCCGACATGATCACTCGGTTGGAAGGG
GAGGAGGAGTCT----------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------CTTGTCACCTACCAGCGAAGTGTCCTGGCCCTGCGAAGGGCACACGACTACCAGGTGGCTCAGATGGGAAATGCAGACGAGACGCCCAT
TTGCTTGGAGGTGCCCTCAAGGGTGACTGTGGACAACCAGGGTGAAAAGCCGGTCTTGGTCAAGACGCCAGGCAGGGAGAAACTGAAAATCACGGCTATG
CTTGGCGTCCTGGCTGATGGGAGGAAGTTACCTCCGTACATCATTCTGAGGGGTACGTACATCCCCCCCGGGAAGTTCCCCAGTGGCATGGAAATCCGCT
GCCACCGGTACGGATGGATGACAGAGGACTTGATGCAGGACTGGTTGGAAGTGGTGTGGAGGCGGAGGACTGGCGCCGTGCCCAAGCAGCGGGGGATGCT
GATCCTGAACGGCTTCCGGGGTCACGCCACGGATTCGGTGAAGAGCTCCATGGAAAGCATGAACACTGACATGGTCATCATCCCGGGGGGCCTGACCTCG
CAGCTGCAGGTGTTAGATGTGGTGGTCTACAAACCGCTGAATGACAGTGTCCGGGCGCAGTACTCCAATTGGCTTCTGGCGGGAAACCTGGCGCTGAGCC
CCACTGGGAACGCCAAGAAGCCGCCCCTttGCCTCTTTCTGGAGTGGGTCATGGTAGCGTGGAACAGCATCTCAAGTGAATCCATTGTCCAAGGGTTCAA
GAAGTGCCACATCTCCAGCAACTTGGAAGATGAAGATGACGTCCTATGGGAAATTGAGAGCGAGTTGCCAGGAGGAGGGGAGCCACCCAAAGAGTGTGAC
ACGGAGAGCCTGACAGAGAGCAACTGA


>BGISUSP0000877798
MESTAYPLFVLKEEEQEEEIRSRELEDGPPDMQKVRICSEGGWVPALFDEVAIYFSDEEWEVLTEQQKALYREVMRMNYETVLSL-FPFPKPDMITRLEG
EEES------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------LVTYQRSVLALRRAHDYQVAQMGNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAM
LGVLADGRKLPPYIILRGTYIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDSVKSSMESMNTDMVIIPGGLTS
QLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLCLFLEWVMVAWNSISSESIVQGFKKCHISSNLEDEDDVLWEIESELPGGGEPPKECD
TESLTESN*