Sequences
EST Library Info
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000143194 (click for geneview)
Transcript ID ENST00000271416(link to ensembl)
Symbol NP_116247.1
Localtion Chromosome:1:163690174:163723105:1 band: 1q24.1
Description hypothetical protein FLJ14904
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--N--R--K--A--S--R--N--A--Y--Y--F--F--V--Q--E--K--I--P--E--L--R--R--R--G--L--P--V--A--R--V--A--
ATGCCGAACCGTAAGGCCAGCCGGAATGCTTACTATTTCTTCGTGCAGGAGAAGATCCCCGAACTACGGCGACGAGGCCTGCCTGTGGCTCGCGTTGCTG
:::::.:::::.:.:: :::::: :::::.::::::::::::::::::::.::::::::.::::::::  :: :::::::::: ::::::::.::.::::
ATGCCAAACCGCAGGGGCAGCCGCAATGCCTACTATTTCTTCGTGCAGGAAAAGATCCCTGAACTACGTAGAAGAGGCCTGCCGGTGGCTCGTGTCGCTG
-M--P--N--R--R--G--S--R--N--A--Y--Y--F--F--V--Q--E--K--I--P--E--L--R--R--R--G--L--P--V--A--R--V--A--

-------------------------------><-------------------------------------------------------------------
D--A--I--P--Y--C--S--S--D--W--A--L--L--R--E--E--E--K--E--K--Y--A--E--M--A--R--E--W--R--A--A--Q--G--K
ATGCCATCCCTTACTGCTCCTCAGACTGGGCGCTTCTGAGGGAGGAAGAAAAGGAGAAATACGCAGAAATGGCTCGAGAATGGAGGGCCGCTCAGGGAAA
:::::::::::::::::::. : ::::::::::: :::::::::::.::::::::::::::: ::::::::::::::::.::::.::::::.:::::.::
ATGCCATCCCTTACTGCTCTGCTGACTGGGCGCTACTGAGGGAGGAGGAAAAGGAGAAATACTCAGAAATGGCTCGAGAGTGGAAGGCCGCCCAGGGGAA
D--A--I--P--Y--C--S--A--D--W--A--L--L--R--E--E--E--K--E--K--Y--S--E--M--A--R--E--W--K--A--A--Q--G--K

------------------------><--------------------------------------------------------------------------
--D--P--G--P--S--E--K--Q--K--P--V--F--T--P--L--R--R--P--G--M--L--V--P--K--Q--N--V--S--P--P--D--M--S-
GGACCCTGGGCCCTCAGAGAAGCAGAAACCTGTTTTCACACCACTGAGGAGGCCAGGCATGCTTGTACCAAAGCAGAATGTTTCACCTCCAGATATGTCA
:::: :::::::.: .:::::::::::::::::::..:: :: :::::::::::::  ::::::::::::::::::::::::::::::::::::::::::
GGACGCTGGGCCTTGGGAGAAGCAGAAACCTGTTTCTACTCCTCTGAGGAGGCCAGCAATGCTTGTACCAAAGCAGAATGTTTCACCTCCAGATATGTCA
--D--A--G--P--W--E--K--Q--K--P--V--S--T--P--L--R--R--P--A--M--L--V--P--K--Q--N--V--S--P--P--D--M--S-

------------------------><--------------------------------------------------------------------------
-A--L--S--L--K--G--D--Q--A--L--L--G--G--I--F--Y--F--L--N--I--F--S--H--G--E--L--P--P--H--C--E--Q--R--
GCTTTGTCTTTAAAAGGTGATCAAGCTCTCCTTGGAGGCATTTTTTATTTTTTGAACATTTTTAGCCATGGCGAGCTACCTCCTCATTGTGAACAGCGCT
  .::::::::::::.::::::::   :::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGCTTGTCTTTAAAAAGTGATCAA---CTCCTTGGAGGTATTTTTTATTTTTTGAACATTTTTAGCCATGGCGAGCTACCTCCTCATTGTGAACAGCGCT
-C--L--S--L--K--S--D--Q-----L--L--G--G--I--F--Y--F--L--N--I--F--S--H--G--E--L--P--P--H--C--E--Q--R--

--------------------------------------------------------------------------------><------------------
F--L--P--C--E--I--G--C--V--K--Y--S--L--Q--E--G--I--M--A--D--F--H--S--F--I--N--P--G--E--I--P--R--G--F
TCCTCCCTTGTGAAATTGGCTGTGTTAAGTATTCTCTCCAAGAAGGTATTATGGCAGATTTCCACAGTTTTATAAATCCTGGTGAAATTCCACGAGGATT
:::::::::::::::: :::::::::::.::.::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::::::::
TCCTCCCTTGTGAAATAGGCTGTGTTAAATACTCTCTCCAAGAAGGTATTATGGCAGATTTCCACAGTTTTATAAATCCT---GAAATTCCACGAGGATT
F--L--P--C--E--I--G--C--V--K--Y--S--L--Q--E--G--I--M--A--D--F--H--S--F--I--N--P-----E--I--P--R--G--F

----------------------><----------------------------------------------------------------------------
--R--F--H--C--Q--A--A--S--D--S--S--H--K--I--P--I--S--N--F--E--R--G--H--N--Q--A--T--V--L--Q--N--L--Y-
TCGATTTCATTGTCAGGCTGCAAGTGATTCTAGTCACAAGATTCCTATTTCAAATTTTGAACGTGGGCATAACCAAGCAACTGTGTTACAAAACCTTTAT
:::::::::::::::::::      ::::::::::::::::::::::::::: ::::::::. :::::::.:.:::::::::::::::::::::::::::
TCGATTTCATTGTCAGGCT------GATTCTAGTCACAAGATTCCTATTTCACATTTTGAATCTGGGCATGATCAAGCAACTGTGTTACAAAACCTTTAT
--R--F--H--C--Q--A--------D--S--S--H--K--I--P--I--S--H--F--E--S--G--H--D--Q--A--T--V--L--Q--N--L--Y-

-----------------------------------------------><---------------------------------------------------
-R--F--I--H--P--N--P--G--N--W--P--P--I--Y--C--K--S--D--D--R--T--R--V--N--W--C--L--K--H--M--A--K--A--
AGATTTATTCATCCCAACCCAGGGAACTGGCCACCTATCTACTGCAAGTCTGATGATAGAACCAGAGTCAACTGGTGTTTGAAGCATATGGCAAAGGCAT
::::::::::.::: :::.::::::: :::::::::::.:::::::::::::::::::::.:::::::::::::::::::::::.::::::::::: :::
AGATTTATTCGTCCAAACTCAGGGAAGTGGCCACCTATTTACTGCAAGTCTGATGATAGAGCCAGAGTCAACTGGTGTTTGAAGTATATGGCAAAGTCAT
-R--F--I--R--P--N--S--G--K--W--P--P--I--Y--C--K--S--D--D--R--A--R--V--N--W--C--L--K--Y--M--A--K--S--

--><------------------------------------------------------------------------------------------------
S--E--I--R--Q--D--L--Q--L--L--T--V--E--D--L--V--V--G--I--Y--Q--Q--K--F--L--K--E--P--S--K--T--W--I--R
CAGAAATCAGGCAAGATCTACAACTTCTCACTGTAGAGGACCTTGTAGTGGGGATCTACCAACAAAAATTTCTCAAGGAGCCCTCTAAGACTTGGATTCG
::   ::.::::::: :::: :::::::::::::::::::::::::..:.:::::::: ::.::::::::::::::.::::.:::::::: .:::.::.:
CA---ATTAGGCAAGCTCTAGAACTTCTCACTGTAGAGGACCTTGTGATAGGGATCTAGCAGCAAAAATTTCTCAAAGAGCTCTCTAAGAGCTGGGTTTG
S-----I--R--Q--A--L--E--L--L--T--V--E--D--L--V--I--G--I--*--Q--Q--K--F--L--K--E--L--S--K--S--W--V--W

--------------------------------------------><------------------------------------------------------
--S--L--L--D--V--A--M--W--D--Y--S--S--N--T--R--C--K--W--H--E--E--N--D--I--L--F--C--A--L--A--V--C--K-
AAGCCTCCTAGATGTGGCCATGTGGGATTATTCTAGCAACACAAGGTGCAAGTGGCATGAAGAAAATGATATTCTCTTCTGTGCTTTAGCTGTTTGCAAG
.::::.:::::::.:::::::::::::::::::::::::::::   ::::::::::::::::::::::::::.:::::::::::::::::::::::::.:
GAGCCCCCTAGATATGGCCATGTGGGATTATTCTAGCAACACA---TGCAAGTGGCATGAAGAAAATGATATCCTCTTCTGTGCTTTAGCTGTTTGCAGG
--S--P--L--D--M--A--M--W--D--Y--S--S--N--T-----C--K--W--H--E--E--N--D--I--L--F--C--A--L--A--V--C--R-

-------><-------------------------------------------------------------------------------------------
-K--I--A--Y--C--I--S--N--S--L--A--T--L--F--G--I--Q--L--T--E--A--H--V--P--L--Q--D--Y--E--A--S--N--S--
AAGATTGCGTACTGCATCAGTAATTCTCTGGCCACTCTCTTTGGAATCCAGCTCACAGAGGCTCATGTACCACTACAAGATTATGAGGCCAGCAATAGTG
::.:::   ::.::: :::::::::::::::::::::::::::::::::::::::::::::::::::: ::::: :::::::::::::::::::::::::
AAAATT---TATTGCCTCAGTAATTCTCTGGCCACTCTCTTTGGAATCCAGCTCACAGAGGCTCATGTTCCACTCCAAGATTATGAGGCCAGCAATAGTG
-K--I-----Y--C--L--S--N--S--L--A--T--L--F--G--I--Q--L--T--E--A--H--V--P--L--Q--D--Y--E--A--S--N--S--

----------------------------------------><----------------------------------------------------------
V--T--P--K--M--V--V--L--D--A--G--R--Y--Q--K--L--R--V--G--S--S--G--F--S--H--F--N--S--S--N--E--E--Q--R
TGACACCCAAAATGGTTGTATTGGATGCAGGGCGTTACCAGAAGCTAAGGGTTGGGAGTTCAGGATTCTCTCATTTCAACTCTTCTAATGAGGAACAAAG
::::::::::::::::::::::::::::::::::.:::::::::::.:::::::.:::::::::::::::::::::::.:::::::::: ::::.:::::
TGACACCCAAAATGGTTGTATTGGATGCAGGGCGCTACCAGAAGCTGAGGGTTGAGAGTTCAGGATTCTCTCATTTCAGCTCTTCTAATCAGGAGCAAAG
V--T--P--K--M--V--V--L--D--A--G--R--Y--Q--K--L--R--V--E--S--S--G--F--S--H--F--S--S--S--N--Q--E--Q--R

----------------><----------------------------------------------------------------------------------
--S--N--T--P--I--G--D--Y--P--S--R--A--K--I--S--G--Q--N--S--S--V--R--G--R--G--I--T--R--L--L--E--S--I-
ATCAAACACACCCATTGGTGACTACCCATCTAGGGCAAAAATTTCTGGCCAAAACAGCAGCGTTCGGGGAAGAGGAATTACCCGCTTACTAGAGAGCATT
:::::::::::::      ::::::::::::.:::..::::::::::::::::.::::::.::::::::::::::.::::::::::::.::::::::::.
ATCAAACACACCC------GACTACCCATCTGGGGTGAAAATTTCTGGCCAAAGCAGCAGTGTTCGGGGAAGAGGGATTACCCGCTTATTAGAGAGCATC
--S--N--T--P--------D--Y--P--S--G--V--K--I--S--G--Q--S--S--S--V--R--G--R--G--I--T--R--L--L--E--S--I-

----------------------------------------------------------------------------------------------------
-S--N--S--S--S--N--I--H--K--F--S--N--C--D--T--S--L--S--P--Y--M--S--Q--K--D--G--Y--K--S--F--S--S--L--
TCCAATTCTTCCAGCAATATCCACAAATTCTCCAACTGTGACACTTCACTCTCACCTTACATGTCCCAAAAAGATGGATACAAATCTTTCTCTTCCTTAT
::::::::.::::::::::::::::::::::::: ::::::  :::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TCCAATTCCTCCAGCAATATCCACAAATTCTCCACCTGTGAGTCTTCACTCTCACCTTACATGTCCCAAAAAGATGGATACAAATCTTTCTCTTCCTTAT
-S--N--S--S--S--N--I--H--K--F--S--T--C--E--S--S--L--S--P--Y--M--S--Q--K--D--G--Y--K--S--F--S--S--L--

---->
S--*-
CTTAA
:::::
CTTAA
S--*-

Pig Consensus Sequence

>BGISUST0000893831
ATGCCAAACCGCAGGGGCAGCCGCAATGCCTACTATTTCTTCGTGCAGGAAAAGATCCCTGAACTACGTAGAAGAGGCCTGCCGGTGGCTCGTGTCGCTG
ATGCCATCCCTTACTGCTCTGCTGACTGGGCGCTACTGAGGGAGGAGGAAAAGGAGAAATACTCAGAAATGGCTCGAGAGTGGAAGGCCGCCCAGGGGAA
GGACGCTGGGCCTTGGGAGAAGCAGAAACCTGTTTCTACTCCTCTGAGGAGGCCAGCAATGCTTGTACCAAAGCAGAATGTTTCACCTCCAGATATGTCA
TGCTTGTCTTTAAAAAGTGATCAA---CTCCTTGGAGGTATTTTTTATTTTTTGAACATTTTTAGCCATGGCGAGCTACCTCCTCATTGTGAACAGCGCT
TCCTCCCTTGTGAAATAGGCTGTGTTAAATACTCTCTCCAAGAAGGTATTATGGCAGATTTCCACAGTTTTATAAATCCT---GAAATTCCACGAGGATT
TCGATTTCATTGTCAGGCT------GATTCTAGTCACAAGATTCCTATTTCACATTTTGAATCTGGGCATGATCAAGCAACTGTGTTACAAAACCTTTAT
AGATTTATTCGTCCAAACTCAGGGAAGTGGCCACCTATTTACTGCAAGTCTGATGATAGAGCCAGAGTCAACTGGTGTTTGAAGTATATGGCAAAGTCAT
CA---ATTAGGCAAGCTCTAGAACTTCTCACTGTAGAGGACCTTGTGATAGGGATCTAGCAGCAAAAATTTCTCAAAGAGCTCTCTAAGAGCTGGGTTTG
GAGCCCCCTAGATATGGCCATGTGGGATTATTCTAGCAACACA---TGCAAGTGGCATGAAGAAAATGATATCCTCTTCTGTGCTTTAGCTGTTTGCAGG
AAAATT---TATTGCCTCAGTAATTCTCTGGCCACTCTCTTTGGAATCCAGCTCACAGAGGCTCATGTTCCACTCCAAGATTATGAGGCCAGCAATAGTG
TGACACCCAAAATGGTTGTATTGGATGCAGGGCGCTACCAGAAGCTGAGGGTTGAGAGTTCAGGATTCTCTCATTTCAGCTCTTCTAATCAGGAGCAAAG
ATCAAACACACCC------GACTACCCATCTGGGGTGAAAATTTCTGGCCAAAGCAGCAGTGTTCGGGGAAGAGGGATTACCCGCTTATTAGAGAGCATC
TCCAATTCCTCCAGCAATATCCACAAATTCTCCACCTGTGAGTCTTCACTCTCACCTTACATGTCCCAAAAAGATGGATACAAATCTTTCTCTTCCTTAT
CTTAA


>BGISUSP0000893831
MPNRRGSRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSADWALLREEEKEKYSEMAREWKAAQGKDAGPWEKQKPVSTPLRRPAMLVPKQNVSPPDMS
CLSLKSDQ-LLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINP-EIPRGFRFHCQA--DSSHKIPISHFESGHDQATVLQNLY
RFIRPNSGKWPPIYCKSDDRARVNWCLKYMAKSS-IRQALELLTVEDLVIGI*QQKFLKELSKSWVWSPLDMAMWDYSSNT-CKWHEENDILFCALAVCR
KI-YCLSNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVESSGFSHFSSSNQEQRSNTP--DYPSGVKISGQSSSVRGRGITRLLESI
SNSSSNIHKFSTCESSLSPYMSQKDGYKSFSSLS*