Sequences
EST Library Info
ecc1Foetus 50 days, cortex cerebri
ese3Foetus 50 days, M. semitendinosus
eye2Foetus 50 days, Eye
hea2Heart
hyp2Hypothalamus
mgp2Mammary gland - 7 days pre birth
ova1Ovary
sin2Small intestine
spl2Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000143889 (click for geneview)
Transcript ID ENST00000272249(link to ensembl)
Symbol HNRPLL
Localtion Chromosome:2:38702828:38741675:-1 band: 2p22.1
Description Heterogeneous nuclear ribonucleoprotein L-like (Stromal RNA regulating factor) (BLOCK24 protein). [Source:Uniprot/SWISSPROT;Acc:Q8WVV9]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--S--S--S--S--S--P--R--E--T--Y--E--E--D--R--E--Y--E--S--Q--A--K--R--L--K--T--E--E--G--E--I--D--
ATGTCCTCCTCCTCTTCCTCCCCCAGGGAGACGTACGAGGAGGACCGGGAGTACGAGAGCCAGGCCAAGCGTCTCAAGACCGAGGAGGGGGAGATCGACT
:::::::::::::: ::::::::.:::::::::::.::::::::::::::.::::::::::::::::::::.:::::::::::::::::.::.:::::::
ATGTCCTCCTCCTCATCCTCCCCTAGGGAGACGTATGAGGAGGACCGGGAATACGAGAGCCAGGCCAAGCGCCTCAAGACCGAGGAGGGAGAAATCGACT
-M--S--S--S--S--S--S--P--R--E--T--Y--E--E--D--R--E--Y--E--S--Q--A--K--R--L--K--T--E--E--G--E--I--D--

----------------------------------------------------------------------------------------><----------
Y--S--A--E--E--G--E--N--R--R--E--A--T--P--R--G--G--G--D--G--G--G--G--G--R--S--F--S--Q--P--E--A--G--G
ACTCGGCCGAGGAAGGCGAGAACCGCCGGGAAGCGACGCCCCGGGGCGGGGGCGATGGCGGCGGCGGCGGCCGGAGCTTCTCTCAGCCGGAGGCAGGTGG
:::: :: ::::::::::::::.:::::::::::::::::::::.:::::::::::   :::.::::::::::::::::::: :::::::::::::::::
ACTCTGCGGAGGAAGGCGAGAATCGCCGGGAAGCGACGCCCCGGAGCGGGGGCGAT---GGCAGCGGCGGCCGGAGCTTCTCACAGCCGGAGGCAGGTGG
Y--S--A--E--E--G--E--N--R--R--E--A--T--P--R--S--G--G--D-----G--S--G--G--R--S--F--S--Q--P--E--A--G--G

----------------------------------------------------------------------------------------------------
--S--H--H--K--V--S--V--S--P--V--V--H--V--R--G--L--C--E--S--V--V--E--A--D--L--V--E--A--L--E--K--F--G-
AAGTCATCATAAAGTTTCTGTTTCACCCGTCGTCCATGTTCGAGGACTCTGTGAATCTGTGGTGGAAGCAGACCTCGTGGAAGCGCTGGAAAAATTTGGG
:::::::::::::::::::::::::::.::.::::::::::::::::::::::::::::::::::::::::::::::::::.:: :::::::::::::::
AAGTCATCATAAAGTTTCTGTTTCACCTGTTGTCCATGTTCGAGGACTCTGTGAATCTGTGGTGGAAGCAGACCTCGTGGAGGCTCTGGAAAAATTTGGG
--S--H--H--K--V--S--V--S--P--V--V--H--V--R--G--L--C--E--S--V--V--E--A--D--L--V--E--A--L--E--K--F--G-

-------><-------------------------------------------------------------------------------------------
-T--I--C--Y--V--M--M--M--P--F--K--R--Q--A--L--V--E--F--E--N--I--D--S--A--K--E--C--V--T--F--A--A--D--
ACAATATGCTATGTGATGATGATGCCATTTAAACGACAGGCTCTAGTGGAATTTGAAAACATAGATAGTGCCAAAGAATGTGTGACATTTGCTGCAGATG
::::::   ::::::::::::::::::::::::::.::::::::::::::::::::.:::::::::::::::::::::::::::::.:::::::::::::
ACAATA---TATGTGATGATGATGCCATTTAAACGGCAGGCTCTAGTGGAATTTGAGAACATAGATAGTGCCAAAGAATGTGTGACGTTTGCTGCAGATG
-T--I-----Y--V--M--M--M--P--F--K--R--Q--A--L--V--E--F--E--N--I--D--S--A--K--E--C--V--T--F--A--A--D--

----------------------------------------------------------------------------------------------------
E--P--V--Y--I--A--G--Q--Q--A--F--F--N--Y--S--T--S--K--R--I--T--R--P--G--N--T--D--D--P--S--G--G--N--K
AACCCGTGTACATTGCTGGTCAACAGGCTTTTTTCAACTATTCTACAAGCAAAAGGATCACTCGGCCAGGAAATACTGATGATCCATCAGGAGGCAACAA
::::::::::::: ::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AACCCGTGTACATAGCTGGTCAGCAGGCTTTTTTCAACTACTCTACAAGCAAAAGGATCACTCGGCCAGGAAATACTGATGATCCATCAGGAGGCAACAA
E--P--V--Y--I--A--G--Q--Q--A--F--F--N--Y--S--T--S--K--R--I--T--R--P--G--N--T--D--D--P--S--G--G--N--K

---------------------------------------------><-----------------------------------------------------
--V--L--L--L--S--I--Q--N--P--L--Y--P--I--T--V--D--V--L--Y--T--V--C--N--P--V--G--K--V--Q--R--I--V--I-
AGTTCTTCTGCTCTCAATTCAGAATCCGCTTTATCCAATTACAGTGGATGTTTTATATACTGTATGCAACCCTGTTGGCAAAGTGCAACGTATTGTTATA
::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::.:::::::: :::::::::::::::::::::
AGTTCTTCTGCTCTCAATTCAGAATCCTCTTTATCCAATTACAGTGGATGTTTTATATACTGTATGCAATCCTGTTGGAAAAGTGCAACGTATTGTTATA
--V--L--L--L--S--I--Q--N--P--L--Y--P--I--T--V--D--V--L--Y--T--V--C--N--P--V--G--K--V--Q--R--I--V--I-

--------------------------><------------------------------------------------------------------------
-F--K--R--N--G--I--Q--A--M--L--M--F--E--S--V--L--C--A--Q--K--A--K--A--A--L--N--G--A--D--I--Y--A--G--
TTCAAGAGAAATGGGATACAAGCAATGCTTATGTTTGAATCAGTCCTTTGTGCCCAGAAAGCTAAAGCAGCACTCAATGGAGCTGATATATATGCTGGAT
::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::: ::::
TTTAAGAGAAATGGGATACAAGCAATGCTTATGTTTGAATCAGTCCTTTGTGCCCAGAAAGCTAAAGCAGCACTCAATGGAGCAGATATATATGCGGGAT
-F--K--R--N--G--I--Q--A--M--L--M--F--E--S--V--L--C--A--Q--K--A--K--A--A--L--N--G--A--D--I--Y--A--G--

----------------------------><----------------------------------------------------------------------
C--C--T--L--K--I--E--Y--A--R--P--T--R--L--N--V--I--R--N--D--N--D--S--W--D--Y--T--K--P--Y--L--G--R--R
GTTGCACACTAAAAATTGAATATGCACGGCCAACTCGTCTAAATGTTATTAGGAATGACAATGACAGTTGGGACTACACTAAACCATATTTGGGAAGACG
::::::: :::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::
GTTGCACCCTAAAAATTGAATATGCAAGGCCAACTCGTCTAAATGTTATTAGGAATGACAATGACAGTTGGGACTACACTAAACCATATTTGGGGAGACG
C--C--T--L--K--I--E--Y--A--R--P--T--R--L--N--V--I--R--N--D--N--D--S--W--D--Y--T--K--P--Y--L--G--R--R

-><----------------------------------------------------------------------><-------------------------
--D--R--G--K--G--R--Q--R--Q--A--I--L--G--E--H--P--S--S--F--R--H--D--G--Y--G--S--H--G--P--L--L--P--L-
AGATAGAGGAAAGGGTCGCCAGAGACAAGCCATTTTGGGAGAACACCCTTCTTCGTTTAGACATGATGGCTATGGATCCCATGGTCCATTATTGCCTTTA
:   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::.:::::.::::::
A---AGAGGAAAGGGTCGCCAGAGACAAGCCATTTTGGGAGAACACCCTTCTTCGTTTAGACATGATGGCTAT---TCCCATGGTCCGTTATTACCTTTA
-----R--G--K--G--R--Q--R--Q--A--I--L--G--E--H--P--S--S--F--R--H--D--G--Y-----S--H--G--P--L--L--P--L-

----------------------------------------------------------------------------------------------------
-P--S--R--Y--R--M--G--S--R--D--T--P--E--L--V--A--Y--P--L--P--Q--A--S--S--S--Y--M--H--G--G--N--P--S--
CCAAGTCGTTACAGAATGGGCTCTCGAGATACACCTGAACTTGTTGCTTATCCATTACCACAGGCTTCTTCCTCTTACATGCATGGAGGAAATCCCTCTG
::::::::::::::::::::::::::::::::::::::.::::::::.::::::::.:::::::::::::::::::::::::::::::::::::::::::
CCAAGTCGTTACAGAATGGGCTCTCGAGATACACCTGAGCTTGTTGCCTATCCATTGCCACAGGCTTCTTCCTCTTACATGCATGGAGGAAATCCCTCTG
-P--S--R--Y--R--M--G--S--R--D--T--P--E--L--V--A--Y--P--L--P--Q--A--S--S--S--Y--M--H--G--G--N--P--S--

-------------------------------------------------------------------------------------------><-------
G--S--V--V--M--V--S--G--L--H--Q--L--K--M--N--C--S--R--V--F--N--L--F--C--L--Y--G--N--I--E--K--V--K--F
GTTCAGTTGTAATGGTTAGTGGATTACATCAACTAAAAATGAATTGTTCAAGAGTCTTCAACCTGTTCTGCTTATATGGAAATATTGAGAAGGTAAAATT
::::::::::.::::::::::::::::::::..:::::::::::::::::::::::::.:::::.:::::::::::::::::::::::.:::::::::::
GTTCAGTTGTGATGGTTAGTGGATTACATCAGTTAAAAATGAATTGTTCAAGAGTCTTTAACCTATTCTGCTTATATGGAAATATTGAAAAGGTAAAATT
G--S--V--V--M--V--S--G--L--H--Q--L--K--M--N--C--S--R--V--F--N--L--F--C--L--Y--G--N--I--E--K--V--K--F

----------------------------------------------------------------------------------------------------
--M--K--T--I--P--G--T--A--L--V--E--M--G--D--E--Y--A--V--E--R--A--V--T--H--L--N--N--V--K--L--F--G--K-
TATGAAGACCATTCCTGGTACAGCACTGGTAGAAATGGGTGATGAGTATGCTGTAGAAAGAGCTGTCACACACCTTAATAATGTCAAATTATTTGGGAAA
:::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.:::::.::::: :::::::::::::::
TATGAAGACCATTCCTGGTACAGCACTAGTAGAAATGGGTGATGAGTATGCTGTAGAAAGAGCTGTCACACATCTTAACAATGTGAAATTATTTGGGAAA
--M--K--T--I--P--G--T--A--L--V--E--M--G--D--E--Y--A--V--E--R--A--V--T--H--L--N--N--V--K--L--F--G--K-

-------------><-------------------------------------------------------------------------------------
-R--L--N--V--C--V--S--K--Q--H--S--V--V--P--S--Q--I--F--E--L--E--D--G--T--S--S--Y--K--D--F--A--M--S--
AGACTTAATGTTTGCGTGTCTAAACAACATTCAGTTGTTCCAAGTCAAATATTTGAGCTGGAGGATGGTACCAGCAGCTACAAAGATTTTGCAATGAGCA
::::::::::::   :: :::::::::::::::::::::::::::::::::::.::::: ::::::::::: ::.::::::::.::::::::::::::::
AGACTTAATGTT---GTTTCTAAACAACATTCAGTTGTTCCAAGTCAAATATTCGAGCTTGAGGATGGTACAAGTAGCTACAAGGATTTTGCAATGAGCA
-R--L--N--V-----V--S--K--Q--H--S--V--V--P--S--Q--I--F--E--L--E--D--G--T--S--S--Y--K--D--F--A--M--S--

----------------------------------------------------------------------------------------------------
K--N--N--R--F--T--S--A--G--Q--A--S--K--N--I--I--Q--P--P--S--C--V--L--H--Y--Y--N--V--P--L--C--V--T--E
AAAATAATCGCTTTACAAGTGCTGGCCAAGCATCTAAGAATATAATCCAGCCACCCTCCTGTGTTTTGCATTATTATAATGTTCCATTGTGTGTCACAGA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::: .:::::::::::::.:::::.::::::::::::::
AAAATAATCGCTTTACAAGTGCTGGCCAAGCATCTAAGAATATAATCCAGCCACCCTCGTGTGTGCTGCATTATTATAACGTTCCGTTGTGTGTCACAGA
K--N--N--R--F--T--S--A--G--Q--A--S--K--N--I--I--Q--P--P--S--C--V--L--H--Y--Y--N--V--P--L--C--V--T--E

---------------><--------------------------------------------------------><-------------------------
--E--T--F--T--K--L--C--N--D--H--E--V--L--T--F--I--K--Y--K--V--F--D--A--K--P--S--A--K--T--L--S--G--L-
AGAGACCTTCACAAAGTTGTGTAATGACCATGAAGTTCTTACATTCATCAAATATAAAGTGTTTGATGCAAAACCTTCAGCCAAAACACTTTCTGGGCTA
:::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :: ::::::::::::::::::::.
AGAAACCTTCACAAAGTTGTGTAATGACCATGAAGTTCTTACATTCATCAAATATAAAGTGTTTGATGCAAAA---TCTGCCAAAACACTTTCTGGGCTG
--E--T--F--T--K--L--C--N--D--H--E--V--L--T--F--I--K--Y--K--V--F--D--A--K-----S--A--K--T--L--S--G--L-

------------------------------------------------------------------------><--------------------------
-L--E--W--E--C--K--T--D--A--V--E--A--L--T--A--L--N--H--Y--Q--I--R--V--P--N--G--S--N--P--Y--T--L--K--
TTAGAATGGGAGTGCAAAACTGATGCAGTAGAAGCCCTTACGGCACTGAATCACTATCAGATAAGAGTGCCGAATGGTTCCAATCCCTATACATTGAAGC
:::::::::::.:::::::::::::::::::::::::::::.:::::.::::::::.:::::::::::       ::::::::::::::.:::.::::::
TTAGAATGGGAATGCAAAACTGATGCAGTAGAAGCCCTTACAGCACTAAATCACTACCAGATAAGAGTT------GGTTCCAATCCCTACACACTGAAGC
-L--E--W--E--C--K--T--D--A--V--E--A--L--T--A--L--N--H--Y--Q--I--R--V--------G--S--N--P--Y--T--L--K--

---------------------------->
L--C--F--S--T--S--S--H--L--*-
TTTGCTTTTCTACATCATCCCATTTATAA
:::::::::::::::::::::::::::::
TTTGCTTTTCTACATCATCCCATTTATAA
L--C--F--S--T--S--S--H--L--*-

Pig Consensus Sequence

>BGISUST0000901527
ATGTCCTCCTCCTCATCCTCCCCTAGGGAGACGTATGAGGAGGACCGGGAATACGAGAGCCAGGCCAAGCGCCTCAAGACCGAGGAGGGAGAAATCGACT
ACTCTGCGGAGGAAGGCGAGAATCGCCGGGAAGCGACGCCCCGGAGCGGGGGCGATGGCAGCGGCGGCCGGAGCTTCTCACAGCCGGAGGCAGGTGGAAG
TCATCATAAAGTTTCTGTTTCACCTGTTGTCCATGTTCGAGGACTCTGTGAATCTGTGGTGGAAGCAGACCTCGTGGAGGCTCTGGAAAAATTTGGGACA
ATA---TATGTGATGATGATGCCATTTAAACGGCAGGCTCTAGTGGAATTTGAGAACATAGATAGTGCCAAAGAATGTGTGACGTTTGCTGCAGATGAAC
CCGTGTACATAGCTGGTCAGCAGGCTTTTTTCAACTACTCTACAAGCAAAAGGATCACTCGGCCAGGAAATACTGATGATCCATCAGGAGGCAACAAAGT
TCTTCTGCTCTCAATTCAGAATCCTCTTTATCCAATTACAGTGGATGTTTTATATACTGTATGCAATCCTGTTGGAAAAGTGCAACGTATTGTTATATTT
AAGAGAAATGGGATACAAGCAATGCTTATGTTTGAATCAGTCCTTTGTGCCCAGAAAGCTAAAGCAGCACTCAATGGAGCAGATATATATGCGGGATGTT
GCACCCTAAAAATTGAATATGCAAGGCCAACTCGTCTAAATGTTATTAGGAATGACAATGACAGTTGGGACTACACTAAACCATATTTGGGGAGACGA--
-AGAGGAAAGGGTCGCCAGAGACAAGCCATTTTGGGAGAACACCCTTCTTCGTTTAGACATGATGGCTAT---TCCCATGGTCCGTTATTACCTTTACCA
AGTCGTTACAGAATGGGCTCTCGAGATACACCTGAGCTTGTTGCCTATCCATTGCCACAGGCTTCTTCCTCTTACATGCATGGAGGAAATCCCTCTGGTT
CAGTTGTGATGGTTAGTGGATTACATCAGTTAAAAATGAATTGTTCAAGAGTCTTTAACCTATTCTGCTTATATGGAAATATTGAAAAGGTAAAATTTAT
GAAGACCATTCCTGGTACAGCACTAGTAGAAATGGGTGATGAGTATGCTGTAGAAAGAGCTGTCACACATCTTAACAATGTGAAATTATTTGGGAAAAGA
CTTAATGTT---GTTTCTAAACAACATTCAGTTGTTCCAAGTCAAATATTCGAGCTTGAGGATGGTACAAGTAGCTACAAGGATTTTGCAATGAGCAAAA
ATAATCGCTTTACAAGTGCTGGCCAAGCATCTAAGAATATAATCCAGCCACCCTCGTGTGTGCTGCATTATTATAACGTTCCGTTGTGTGTCACAGAAGA
AACCTTCACAAAGTTGTGTAATGACCATGAAGTTCTTACATTCATCAAATATAAAGTGTTTGATGCAAAA---TCTGCCAAAACACTTTCTGGGCTGTTA
GAATGGGAATGCAAAACTGATGCAGTAGAAGCCCTTACAGCACTAAATCACTACCAGATAAGAGTT------GGTTCCAATCCCTACACACTGAAGCTTT
GCTTTTCTACATCATCCCATTTATAA


>BGISUSP0000901527
MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRSGGDGSGGRSFSQPEAGGSHHKVSVSPVVHVRGLCESVVEADLVEALEKFGT
I-YVMMMPFKRQALVEFENIDSAKECVTFAADEPVYIAGQQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIF
KRNGIQAMLMFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRR-RGKGRQRQAILGEHPSSFRHDGY-SHGPLLPLP
SRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKR
LNV-VSKQHSVVPSQIFELEDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDAK-SAKTLSGLL
EWECKTDAVEALTALNHYQIRV--GSNPYTLKLCFSTSSHL*