Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000144648 (click for geneview)
Transcript ID ENST00000273145(link to ensembl)
Symbol CCBP2
Localtion Chromosome:3:42836124:42883778:1 band: 3p22.1
Description Chemokine binding protein 2 (Chemokine-binding protein D6) (C-C chemokine receptor D6) (Chemokine receptor CCR-9) (CC-Chemokine receptor CCR10). [Source:Uniprot/SWISSPROT;Acc:O00590]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--T--A--S--P--Q--P--L--A--T--E--D--A--D--S--E--N--S--S--F--Y--Y--Y--D--Y--L--D--E--V--A--F--
ATGGCCGCCACTGCCTCTCCGCAGCCACTCGCCACTGAGGATGCCGATTCTGAGAATAGCAGCTTCTATTACTATGACTACCTGGATGAAGTGGCCTTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
M--L--C--R--K--D--A--V--V--S--F--G--K--V--F--L--P--V--F--Y--S--L--I--F--V--L--G--L--S--G--N--L--L--L
TGCTCTGCAGGAAGGATGCAGTGGTGTCCTTTGGCAAAGTCTTCCTCCCAGTCTTCTATAGCCTGATTTTTGTGTTGGGCCTCAGCGGGAACCTCCTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--M--V--L--L--R--Y--V--P--R--R--R--M--V--E--I--Y--L--L--N--L--A--I--S--N--L--L--F--L--V--T--L--P-
TCTCATGGTCTTGCTCCGTTACGTGCCTCGCAGGCGGATGGTTGAGATCTATCTGCTGAATCTGGCCATCTCCAACCTTCTGTTTCTGGTGACACTGCCC
                                                                ::::::::::::::.:::::: :::::::.::::::
----------------------------------------------------------------GCCATCTCCAACCTCCTGTTTGTGGTGACGCTGCCC
-----------------------------------------------------------------A--I--S--N--L--L--F--V--V--T--L--P-

----------------------------------------------------------------------------------------------------
-F--W--G--I--S--V--A--W--H--W--V--F--G--S--F--L--C--K--M--V--S--T--L--Y--T--I--N--F--Y--S--G--I--F--
TTCTGGGGCATCTCCGTGGCCTGGCATTGGGTCTTCGGGAGTTTCTTGTGCAAGATGGTGAGCACTCTTTATACTATTAACTTTTACAGTGGCATCTTTT
::::::::::::::.::::::::::::::::::.:.:::::::::::::::::::::::::::::.::.:::::.:::::::: ::::::::::::::.:
TTCTGGGGCATCTCTGTGGCCTGGCATTGGGTCCTTGGGAGTTTCTTGTGCAAGATGGTGAGCACCCTCTATACCATTAACTTGTACAGTGGCATCTTCT
-F--W--G--I--S--V--A--W--H--W--V--L--G--S--F--L--C--K--M--V--S--T--L--Y--T--I--N--L--Y--S--G--I--F--

----------------------------------------------------------------------------------------------------
F--I--S--C--M--S--L--D--K--Y--L--E--I--V--H--A--Q--P--Y--H--R--L--R--T--R--A--K--S--L--L--L--A--T--I
TCATTAGCTGCATGAGCCTGGACAAGTACCTGGAGATCGTTCATGCTCAGCCCTACCACAGGCTGAGGACCCGGGCCAAGAGCCTGCTCCTTGCTACCAT
:::::.:::::::::::::::::::::::::::::::.:: .. :::..::::.::::: .::::::::::::: ::::::::::::::::::. ::..:
TCATTGGCTGCATGAGCCTGGACAAGTACCTGGAGATTGTGTGGGCTTGGCCCCACCACCAGCTGAGGACCCGGTCCAAGAGCCTGCTCCTTGTGACTGT
F--I--G--C--M--S--L--D--K--Y--L--E--I--V--W--A--W--P--H--H--Q--L--R--T--R--S--K--S--L--L--L--V--T--V

----------------------------------------------------------------------------------------------------
--V--W--A--V--S--L--A--V--S--I--P--D--M--V--F--V--Q--T--H--E--N--P--K--G--V--W--N--C--H--A--D--F--G-
AGTATGGGCTGTGTCCCTGGCCGTCTCCATCCCTGATATGGTCTTTGTACAGACACATGAAAATCCCAAGGGTGTGTGGAACTGCCACGCAGATTTCGGC
 ::.::::.:::: :::::::.::::::::::::::.:::::::::::. .::::::::::::.: :  ::.:::::::.:::::.:.::.:::::::: 
CGTGTGGGTTGTGGCCCTGGCTGTCTCCATCCCTGACATGGTCTTTGTGAGGACACATGAAAACCACCCGGATGTGTGGGACTGCTATGCGGATTTCGGG
--V--W--V--V--A--L--A--V--S--I--P--D--M--V--F--V--R--T--H--E--N--H--P--D--V--W--D--C--Y--A--D--F--G-

----------------------------------------------------------------------------------------------------
-G--H--G--T--I--W--K--L--F--L--R--F--Q--Q--N--L--L--G--F--L--L--P--L--L--A--M--I--F--F--Y--S--R--I--
GGGCATGGGACCATTTGGAAGCTCTTCCTCCGCTTCCAGCAGAACCTCCTAGGGTTTCTCCTTCCACTCCTTGCCATGATCTTCTTCTACTCCCGTATTG
::::::::::::::.:::::::::::::::::::::::::::::::::::.:::::::::::.::.:::.: :::::::.:::::::::. ::::.::.:
GGGCATGGGACCATCTGGAAGCTCTTCCTCCGCTTCCAGCAGAACCTCCTGGGGTTTCTCCTCCCGCTCTTGGCCATGACCTTCTTCTATGCCCGCATCG
-G--H--G--T--I--W--K--L--F--L--R--F--Q--Q--N--L--L--G--F--L--L--P--L--L--A--M--T--F--F--Y--A--R--I--

----------------------------------------------------------------------------------------------------
G--C--V--L--V--R--L--R--P--A--G--Q--G--R--A--L--K--I--A--A--A--L--V--V--A--F--F--V--L--W--F--P--Y--N
GTTGTGTCTTGGTGAGGCTGAGGCCCGCAGGCCAGGGCCGGGCTTTAAAAATAGCTGCAGCCTTGGTGGTGGCCTTCTTCGTGCTATGGTTCCCATACAA
:.::::::::::: :::::::::::: :.::.::::::::::::.:::..::.::::.:::::::::::::::::::::.:::::.:::::::::::.::
GCTGTGTCTTGGTCAGGCTGAGGCCCCCGGGTCAGGGCCGGGCTCTAAGGATGGCTGTAGCCTTGGTGGTGGCCTTCTTTGTGCTGTGGTTCCCATATAA
G--C--V--L--V--R--L--R--P--P--G--Q--G--R--A--L--R--M--A--V--A--L--V--V--A--F--F--V--L--W--F--P--Y--N

----------------------------------------------------------------------------------------------------
--L--T--L--F--L--H--T--L--L--D--L--Q--V--F--G--N--C--E--V--S--Q--H--L--D--Y--A--L--Q--V--T--E--S--I-
TCTCACCTTGTTTCTGCATACGCTGTTGGACCTGCAAGTATTCGGGAACTGTGAGGTCAGCCAGCATCTAGACTACGCACTCCAGGTAACAGAGAGCATC
.:::::::::::::::::. :::::.::::::::::::: ::.:::.::::..:::::::::::::.::.::::::: .:: :::::.::::::::::::
CCTCACCTTGTTTCTGCACTCGCTGCTGGACCTGCAAGTCTTTGGGGACTGCAAGGTCAGCCAGCACCTGGACTACGGGCTGCAGGTGACAGAGAGCATC
--L--T--L--F--L--H--S--L--L--D--L--Q--V--F--G--D--C--K--V--S--Q--H--L--D--Y--G--L--Q--V--T--E--S--I-

----------------------------------------------------------------------------------------------------
-A--F--L--H--C--C--F--S--P--I--L--Y--A--F--S--S--H--R--F--R--Q--Y--L--K--A--F--L--A--A--V--L--G--W--
GCCTTCCTTCACTGCTGCTTTTCCCCCATCCTGTATGCCTTCTCCAGTCACCGCTTCCGCCAGTACCTGAAGGCTTTCCTGGCTGCCGTGCTTGGATGGC
::::::::.::::::::: :. ::::..:::: ::.::.::::::::::.:::::::::::.:.:::: :::: :.:::::::.::.:::::..:..:::
GCCTTCCTCCACTGCTGCATCACCCCTGTCCTCTACGCTTTCTCCAGTCGCCGCTTCCGCCGGCACCTTAAGGATCTCCTGGCCGCTGTGCTCAGGCGGC
-A--F--L--H--C--C--I--T--P--V--L--Y--A--F--S--S--R--R--F--R--R--H--L--K--D--L--L--A--A--V--L--R--R--

----------------------------------------------------------------------------------------------------
H--L--A--P--G--T--A--Q--A--S--L--S--S--C--S--E--S--S--I--L--T--A--Q--E--E--M--T--G--M--N--D--L--G--E
ACCTGGCACCTGGCACTGCCCAGGCCTCATTATCCAGCTGTTCTGAGAGCAGCATACTTACTGCCCAAGAGGAAATGACTGGCATGAATGACCTTGGAGA
::: ::: ::: .: .::::::::::.:....::::::: :::::::::::::: .::.::::::::.::.:: .:.::..: ::::::::.::.:.::.
ACCAGGCTCCTTACCTTGCCCAGGCCCCGCCGTCCAGCTCTTCTGAGAGCAGCAGGCTCACTGCCCAGGAAGATGTAACCAGAATGAATGATCTCGAAGG
H--Q--A--P--Y--L--A--Q--A--P--P--S--S--S--S--E--S--S--R--L--T--A--Q--E--D--V--T--R--M--N--D--L--E--G

-------------------------------------------------------
--R--Q--S--E--N--Y--P--N--K--E--D--V--G--N--K--S--A--*-
GAGGCAGTCTGAGAACTACCCTAACAAGGAGGATGTGGGGAATAAATCAGCCTGA
::::::: ::::::    :::.:::::::::.:.:::::::.:  : :       
GAGGCAGGCTGAGAC-GCCCCCAACAAGGAGAACGTGGGGAGTTCAGCC------
--R--Q--A--E--N--A--P--N--K--E--N--V--G--S--S--A-------

Pig Consensus Sequence

>BGISUST0000883129
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------GCCATCTCCAACCTCCTGTTTGTGGTGACGCTGCCC
TTCTGGGGCATCTCTGTGGCCTGGCATTGGGTCCTTGGGAGTTTCTTGTGCAAGATGGTGAGCACCCTCTATACCATTAACTTGTACAGTGGCATCTTCT
TCATTGGCTGCATGAGCCTGGACAAGTACCTGGAGATTGTGTGGGCTTGGCCCCACCACCAGCTGAGGACCCGGTCCAAGAGCCTGCTCCTTGTGACTGT
CGTGTGGGTTGTGGCCCTGGCTGTCTCCATCCCTGACATGGTCTTTGTGAGGACACATGAAAACCACCCGGATGTGTGGGACTGCTATGCGGATTTCGGG
GGGCATGGGACCATCTGGAAGCTCTTCCTCCGCTTCCAGCAGAACCTCCTGGGGTTTCTCCTCCCGCTCTTGGCCATGACCTTCTTCTATGCCCGCATCG
GCTGTGTCTTGGTCAGGCTGAGGCCCCCGGGTCAGGGCCGGGCTCTAAGGATGGCTGTAGCCTTGGTGGTGGCCTTCTTTGTGCTGTGGTTCCCATATAA
CCTCACCTTGTTTCTGCACTCGCTGCTGGACCTGCAAGTCTTTGGGGACTGCAAGGTCAGCCAGCACCTGGACTACGGGCTGCAGGTGACAGAGAGCATC
GCCTTCCTCCACTGCTGCATCACCCCTGTCCTCTACGCTTTCTCCAGTCGCCGCTTCCGCCGGCACCTTAAGGATCTCCTGGCCGCTGTGCTCAGGCGGC
ACCAGGCTCCTTACCTTGCCCAGGCCCCGCCGTCCAGCTCTTCTGAGAGCAGCAGGCTCACTGCCCAGGAAGATGTAACCAGAATGAATGATCTCGAAGG
GAGGCAGGCTGAggCCCCCAACAAGGAGAACGTGGGGAGTTCAGCC---


>BGISUSP0000883129
----------------------------------------------------------------------------------------AISNLLFVVTLP
FWGISVAWHWVLGSFLCKMVSTLYTINLYSGIFFIGCMSLDKYLEIVWAWPHHQLRTRSKSLLLVTVVWVVALAVSIPDMVFVRTHENHPDVWDCYADFG
GHGTIWKLFLRFQQNLLGFLLPLLAMTFFYARIGCVLVRLRPPGQGRALRMAVALVVAFFVLWFPYNLTLFLHSLLDLQVFGDCKVSQHLDYGLQVTESI
AFLHCCITPVLYAFSSRRFRRHLKDLLAAVLRRHQAPYLAQAPPSSSSESSRLTAQEDVTRMNDLEGRQAEAPNKENVGSSA-