Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000144771 (click for geneview)
Transcript ID ENST00000273286(link to ensembl)
Symbol NP_065729.1
Localtion Chromosome:3:54927430:54937112:-1 band: 3p14.3
Description HT017 protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----><--------------------------------------------------------------------------------------------
-M--K--G--E--L--L--L--F--S--S--V--I--V--L--L--Q--V--V--C--S--C--P--D--K--C--Y--C--Q--S--S--T--N--F--
ATGAAAGGTGAACTGCTCCTGTTTTCCAGTGTGATTGTCCTGCTCCAGGTGGTATGCAGCTGCCCGGACAAGTGTTACTGTCAGTCATCTACAAATTTTG
                                                   ::.::..:::::::.:: :. ::...:::::: :::.:: : ::::.::
---------------------------------------------------GTGTGTGGCTGCCCAGAGAGTTGCCGCTGTCACTCACCTTCTAATTCTG
----------------------------------------------------V--C--G--C--P--E--S--C--R--C--H--S--P--S--N--S--

----------------------------------------------------------------------------------------------------
V--D--C--S--Q--Q--G--L--A--E--I--P--S--H--L--P--P--Q--T--R--T--L--H--L--Q--D--N--Q--I--H--H--L--P--A
TAGACTGCAGCCAGCAGGGTCTGGCCGAAATCCCTTCCCATTTACCTCCTCAGACTCGAACGCTGCATTTACAAGATAATCAGATACACCATCTTCCTGC
:::::::.::::.:::.::::::::.:::::::::.:. .:::.::::::::::::: .::::::::.::::::::::::::::::::: : ::::: ::
TAGACTGTAGCCGGCAAGGTCTGGCTGAAATCCCTCCTGGTTTGCCTCCTCAGACTCTGACGCTGCACTTACAAGATAATCAGATACACGAGCTTCCGGC
V--D--C--S--R--Q--G--L--A--E--I--P--P--G--L--P--P--Q--T--L--T--L--H--L--Q--D--N--Q--I--H--E--L--P--A

----------------------------------------------------------------------------------------------------
--F--A--F--R--S--V--P--W--L--M--T--L--N--L--S--N--N--S--L--S--N--L--A--P--G--A--F--H--G--L--Q--H--L-
TTTTGCATTTAGGTCAGTGCCATGGCTCATGACCTTAAACTTGTCCAACAATTCCCTTTCAAATCTGGCCCCTGGAGCTTTCCATGGGCTTCAGCACTTG
:::::::::::..:: :::::: .:::::..:::::.:::.::: :::::::::.::::::::::::.:.::.::::.:::::::::.::::::::::::
TTTTGCATTTAAATCCGTGCCAAAGCTCACAACCTTGAACCTGTACAACAATTCTCTTTCAAATCTGACTCCCGGAGTTTTCCATGGACTTCAGCACTTG
--F--A--F--K--S--V--P--K--L--T--T--L--N--L--Y--N--N--S--L--S--N--L--T--P--G--V--F--H--G--L--Q--H--L-

----------------------------------------------------------------------------------------------------
-Q--V--L--N--L--T--Q--N--S--L--L--S--L--E--S--R--L--F--H--S--L--P--Q--L--R--E--L--D--L--S--S--N--N--
CAGGTTTTAAATCTAACCCAGAATTCACTCCTTTCCCTGGAAAGCAGACTTTTCCATTCCCTCCCTCAGCTGAGGGAGCTTGATTTGTCATCAAACAACA
 .:.:.:::::.:::::::::::.:: :: : :::::::::::::::.::::::::::::::::: ::::::::::::::: ::::::::::::::::::
AGGATCTTAAACCTAACCCAGAACTCCCTGCATTCCCTGGAAAGCAGGCTTTTCCATTCCCTCCCACAGCTGAGGGAGCTTTATTTGTCATCAAACAACA
-R--I--L--N--L--T--Q--N--S--L--H--S--L--E--S--R--L--F--H--S--L--P--Q--L--R--E--L--Y--L--S--S--N--N--

----------------------------------------------------------------------------------------------------
I--S--H--L--P--T--S--L--G--E--T--W--E--N--L--T--I--L--A--V--Q--Q--N--Q--L--Q--Q--L--D--R--A--L--L--E
TAAGCCACCTTCCCACATCCTTGGGAGAGACTTGGGAGAACCTAACTATACTTGCGGTTCAACAAAACCAGCTTCAGCAGCTTGATCGAGCGCTCCTGGA
::::.::::::::.:::::::::::::::  .:::::::::::::::.::.::::..::::::::::::.::::::::::::::::::::: :::::.::
TAAGTCACCTTCCTACATCCTTGGGAGAGCACTGGGAGAACCTAACTGTATTTGCAATTCAACAAAACCGGCTTCAGCAGCTTGATCGAGCCCTCCTAGA
I--S--H--L--P--T--S--L--G--E--H--W--E--N--L--T--V--F--A--I--Q--Q--N--R--L--Q--Q--L--D--R--A--L--L--E

----------------------------------------------------------------------------------------------------
--S--M--P--S--V--R--L--L--L--L--K--D--N--L--W--K--C--N--C--H--L--L--G--L--K--L--W--L--E--K--F--V--Y-
ATCCATGCCCAGTGTGAGGCTTTTACTTCTCAAGGACAACCTCTGGAAATGCAATTGCCACTTGCTCGGTCTTAAACTCTGGCTGGAGAAATTTGTCTAT
:::::::::::: ::::::: ::::..:::::.::::::::::::: :::::::::::.::::::::.::::::::::::::::::::: :::..::   
ATCCATGCCCAGAGTGAGGCGTTTATCTCTCAGGGACAACCTCTGGCAATGCAATTGCTACTTGCTCAGTCTTAAACTCTGGCTGGAGACATTCATC---
--S--M--P--R--V--R--R--L--S--L--R--D--N--L--W--Q--C--N--C--Y--L--L--S--L--K--L--W--L--E--T--F--I----

---><-----------------------------------------------------------------------------------------------
-K--G--G--L--T--D--G--I--I--C--E--S--P--D--T--W--K--G--K--D--L--L--R--I--P--H--E--L--Y--Q--P--C--P--
AAAGGGGGACTAACAGACGGCATCATCTGTGAATCACCAGACACCTGGAAGGGAAAGGACCTCCTTAGGATCCCTCATGAGCTGTACCAGCCCTGCCCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--P--A--P--D--P--V--S--S--Q--A--Q--W--P--G--S--A--H--G--V--V--L--R--P--P--E--N--H--N--A--G--E--R--E
TTCCTGCTCCTGATCCAGTGTCCTCGCAGGCTCAGTGGCCCGGCTCTGCCCACGGTGTGGTCCTGAGGCCTCCTGAGAACCACAACGCGGGGGAGCGAGA
           ::.:..: ::::::.::.:. :::..::: ::. :::.:::. . :: ::::. :::::.:::::::.::::...:.::::::.:::::
-----------GACCTGGAGTCCTCACAAGTGCAGCAGCCAGGTGCTGTCCATCAGGTTGTCCCCAGGCCCCCTGAGAGCCACGGTGTGGGGGAACGAGA
------------D--L--E--S--S--Q--V--Q--Q--P--G--A--V--H--Q--V--V--P--R--P--P--E--S--H--G--V--G--E--R--D

----------------------------------------------------------------------------------------------------
--L--L--E--C--E--L--K--P--K--P--R--P--A--N--L--R--H--A--I--A--T--V--I--I--T--G--V--V--C--G--I--V--C-
ACTCTTGGAGTGCGAGCTCAAACCCAAGCCAAGGCCGGCCAACCTGCGTCATGCCATTGCCACTGTCATCATCACTGGCGTTGTGTGTGGGATTGTGTGT
 : :: :.::::.::: ::::::::::::..:::::::::::.:::::.::.::::: :::::..::.:::::::::: ::.::.:::::::::::::::
CCACTGGAAGTGTGAGATCAAACCCAAGCTGAGGCCGGCCAATCTGCGCCACGCCATGGCCACCATCGTCATCACTGGGGTCGTATGTGGGATTGTGTGT
--H--W--K--C--E--I--K--P--K--L--R--P--A--N--L--R--H--A--M--A--T--I--V--I--T--G--V--V--C--G--I--V--C-

----------------------------------------------------------------------------------------------------
-L--M--M--L--A--A--A--I--Y--G--C--T--Y--A--A--I--T--A--Q--Y--H--G--G--P--L--A--Q--T--N--D--P--G--K--
CTCATGATGTTGGCAGCTGCCATCTATGGCTGCACCTATGCGGCAATCACAGCCCAGTACCATGGGGGACCCTTGGCTCAAACCAATGATCCTGGGAAGG
:::::::::::::::::.:::::::::::::::::::::::.:: ::.:: ::::::::::.::.::::: ::::::::::.::::::: :::: ::::.
CTCATGATGTTGGCAGCCGCCATCTATGGCTGCACCTATGCAGCTATTACTGCCCAGTACCGTGAGGGACGCTTGGCTCAAGCCAATGAGCCTGTGAAGA
-L--M--M--L--A--A--A--I--Y--G--C--T--Y--A--A--I--T--A--Q--Y--R--E--G--R--L--A--Q--A--N--E--P--V--K--

------------------------------------->
V--E--E--K--E--R--F--D--S--S--P--A--*-
TGGAAGAAAAAGAGCGATTTGACAGCTCACCAGCCTGA
..::::.:::.:::: ::::::::::::::::::::::
CAGAAGGAAAGGAGCTATTTGACAGCTCACCAGCCTGA
T--E--G--K--E--L--F--D--S--S--P--A--*-

Pig Consensus Sequence

>BGISUST0000883954
---------------------------------------------------GTGTGTGGCTGCCCAGAGAGTTGCCGCTGTCACTCACCTTCTAATTCTG
TAGACTGTAGCCGGCAAGGTCTGGCTGAAATCCCTCCTGGTTTGCCTCCTCAGACTCTGACGCTGCACTTACAAGATAATCAGATACACGAGCTTCCGGC
TTTTGCATTTAAATCCGTGCCAAAGCTCACAACCTTGAACCTGTACAACAATTCTCTTTCAAATCTGACTCCCGGAGTTTTCCATGGACTTCAGCACTTG
AGGATCTTAAACCTAACCCAGAACTCCCTGCATTCCCTGGAAAGCAGGCTTTTCCATTCCCTCCCACAGCTGAGGGAGCTTTATTTGTCATCAAACAACA
TAAGTCACCTTCCTACATCCTTGGGAGAGCACTGGGAGAACCTAACTGTATTTGCAATTCAACAAAACCGGCTTCAGCAGCTTGATCGAGCCCTCCTAGA
ATCCATGCCCAGAGTGAGGCGTTTATCTCTCAGGGACAACCTCTGGCAATGCAATTGCTACTTGCTCAGTCTTAAACTCTGGCTGGAGACATTCATC---
----------------------------------------------------------------------------------------------------
-----------GACCTGGAGTCCTCACAAGTGCAGCAGCCAGGTGCTGTCCATCAGGTTGTCCCCAGGCCCCCTGAGAGCCACGGTGTGGGGGAACGAGA
CCACTGGAAGTGTGAGATCAAACCCAAGCTGAGGCCGGCCAATCTGCGCCACGCCATGGCCACCATCGTCATCACTGGGGTCGTATGTGGGATTGTGTGT
CTCATGATGTTGGCAGCCGCCATCTATGGCTGCACCTATGCAGCTATTACTGCCCAGTACCGTGAGGGACGCTTGGCTCAAGCCAATGAGCCTGTGAAGA
CAGAAGGAAAGGAGCTATTTGACAGCTCACCAGCCTGA


>BGISUSP0000883954
-----------------VCGCPESCRCHSPSNSVDCSRQGLAEIPPGLPPQTLTLHLQDNQIHELPAFAFKSVPKLTTLNLYNNSLSNLTPGVFHGLQHL
RILNLTQNSLHSLESRLFHSLPQLRELYLSSNNISHLPTSLGEHWENLTVFAIQQNRLQQLDRALLESMPRVRRLSLRDNLWQCNCYLLSLKLWLETFI-
-------------------------------------DLESSQVQQPGAVHQVVPRPPESHGVGERDHWKCEIKPKLRPANLRHAMATIVITGVVCGIVC
LMMLAAAIYGCTYAAITAQYREGRLAQANEPVKTEGKELFDSSPA*