Sequences
EST Library Info
cbe1Cerebellum
nmm2Newborn 115 days, mucosal membranes
pliv1Unavailable
ski1Skin
ste2M. Semitendinosus
uio2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000146281 (click for geneview)
Transcript ID ENST00000275072(link to ensembl)
Symbol ACY1L2
Localtion Chromosome:6:89912488:89932000:1 band: 6q15
Description aminoacylase 1-like 2 [Source:RefSeq_peptide;Acc:NP_001010853]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-V--L--E--A--S--G--R--V--R--G--R--S--L--P--A--A--E--P--G--S--E--R--A--Q--R--A--A--G--L--G--S--M--R--
GTCCTGGAGGCCTCTGGGCGCGTGCGCGGGCGGTCGCTACCTGCGGCCGAGCCAGGGAGCGAGAGGGCGCAGAGGGCAGCGGGCTTGGGCAGCATGAGGC
                                                                                       ::::  :::::.:
---------------------------------------------------------------------------------------GGCACGATGAGAC
----------------------------------------------------------------------------------------G--T--M--R--

----------------------------------------------------------------------------------------------------
P--G--G--E--R--P--V--E--G--G--A--C--N--G--R--S--E--L--E--L--L--K--L--R--S--A--E--C--I--D--E--A--A--E
CCGGAGGGGAGCGGCCCGTGGAAGGGGGCGCGTGCAATGGCCGCTCCGAGCTGGAGCTACTGAAGCTGCGCTCGGCGGAGTGCATCGACGAGGCGGCCGA
:::.::.:::::::::::::::.:::::::: :::. .:::  :::: ::::::::::..::::::::::: : ::::: :::::::::::.::::::::
CCGAAGAGGAGCGGCCCGTGGAGGGGGGCGCCTGCGTCGGCGTCTCCCAGCTGGAGCTGTTGAAGCTGCGCGCCGCGGATTGCATCGACGAAGCGGCCGA
P--E--E--E--R--P--V--E--G--G--A--C--V--G--V--S--Q--L--E--L--L--K--L--R--A--A--D--C--I--D--E--A--A--E

----------------------------------------------------------------------------------------------------
--R--L--G--A--L--S--R--A--I--W--S--Q--P--E--L--A--Y--E--E--H--H--A--H--R--V--L--T--H--F--F--E--R--E-
GCGGCTGGGGGCCCTGAGCCGCGCGATCTGGAGCCAGCCCGAGCTGGCCTACGAGGAGCACCATGCCCACCGCGTGCTGACGCACTTCTTCGAGCGGGAG
::: ::::::::.:::::::: :::::::::::: :::: :::.:::::::::::::::::::::::::: ::::::::::::.:::::::::: : :::
GCGCCTGGGGGCTCTGAGCCGAGCGATCTGGAGCAAGCCGGAGTTGGCCTACGAGGAGCACCATGCCCACGGCGTGCTGACGCGCTTCTTCGAGAGCGAG
--R--L--G--A--L--S--R--A--I--W--S--K--P--E--L--A--Y--E--E--H--H--A--H--G--V--L--T--R--F--F--E--S--E-

----------------------------------------------------------------------------------------------------
-P--P--A--A--S--W--A--V--Q--P--H--Y--Q--L--P--T--A--F--R--A--E--W--E--P--P--E--A--R--A--P--S--A--T--
CCGCCCGCGGCCTCCTGGGCAGTGCAGCCGCACTACCAGCTGCCCACGGCCTTCCGCGCCGAGTGGGAGCCGCCGGAGGCCCGGGCACCGAGCGCCACGC
:: :: :: :  :: ::::: ::::::::::::::::::::: ::::::::::::::::::::::::.:::::::    : :::: ...:.  :: ::: 
CCCCCGGCCGGGTCGTGGGCCGTGCAGCCGCACTACCAGCTGGCCACGGCCTTCCGCGCCGAGTGGGGGCCGCCG---CCGCGGGGGTTGGCGGCGACG-
-P--P--A--G--S--W--A--V--Q--P--H--Y--Q--L--A--T--A--F--R--A--E--W--G--P--P-----P--R--G--L--A--A--T--

----------------------------------------------------------------------------------------------------
P--R--P--L--H--L--G--F--L--C--E--Y--D--A--L--P--G--I--G--H--A--C--G--H--N--L--I--A--E--V--G--A--A--A
CACGCCCGCTGCACCTGGGCTTCCTCTGCGAGTACGACGCGCTGCCCGGCATCGGCCACGCCTGCGGCCACAACCTCATCGCTGAGGTCGGGGCGGCGGC
  :::::::::::::::::::::::.::::::::::::::::::::::.:::::: ::::::::::::::.::::: :::::.:::::::::::::::::
--CGCCCGCTGCACCTGGGCTTCCTTTGCGAGTACGACGCGCTGCCCGACATCGGGCACGCCTGCGGCCATAACCTAATCGCCGAGGTCGGGGCGGCGGC
---R--P--L--H--L--G--F--L--C--E--Y--D--A--L--P--D--I--G--H--A--C--G--H--N--L--I--A--E--V--G--A--A--A

---------------------------------------------------------><-----------------------------------------
--A--L--G--V--R--G--A--L--E--G--L--P--R--P--P--P--P--V--K--V--V--V--L--G--T--P--A--E--E--D--G--G--G-
CGCGCTGGGCGTGAGGGGGGCCTTAGAGGGCCTCCCCAGGCCGCCTCCGCCCGTGAAGGTAGTTGTCCTGGGAACCCCTGCAGAAGAAGATGGTGGTGGC
::: :::::.::::.::::  :.:.:::.:::::::..:::::::::.::: :::::::::::::::::::::::.:::::.::::::::::::::::::
CGCCCTGGGTGTGAAGGGGTGCCTGGAGAGCCTCCCTGGGCCGCCTCTGCCGGTGAAGGTAGTTGTCCTGGGAACTCCTGCGGAAGAAGATGGTGGTGGC
--A--L--G--V--K--G--C--L--E--S--L--P--G--P--P--L--P--V--K--V--V--V--L--G--T--P--A--E--E--D--G--G--G-

----------------------------------------------------------------------------------------------------
-K--I--D--L--I--E--A--G--A--F--T--N--L--D--V--V--F--M--A--H--P--S--Q--E--N--A--A--Y--L--P--D--M--A--
AAAATTGATTTAATTGAAGCAGGGGCTTTTACAAATCTTGATGTTGTTTTTATGGCCCACCCATCACAAGAGAATGCTGCTTATCTACCAGATATGGCTG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::.::::: :::::::::::::::::::::::::::...::::
AAAATTGATTTAATTGAAGCAGGGGCTTTTACAAATCTTGATGTTGTTTTTATGGCGCATCCATCTCAAGAGAATGCTGCTTATCTACCAGATGCAGCTG
-K--I--D--L--I--E--A--G--A--F--T--N--L--D--V--V--F--M--A--H--P--S--Q--E--N--A--A--Y--L--P--D--A--A--

------><--------------------------------------------------------------------------------------------
E--H--D--V--T--V--K--Y--Y--G--K--A--S--H--S--A--S--Y--P--W--E--G--L--N--A--L--D--A--A--V--L--A--Y--N
AACATGATGTGACTGTGAAATACTATGGAAAAGCATCTCATTCTGCTTCTTATCCCTGGGAAGGATTAAATGCATTAGATGCTGCTGTGCTGGCCTATAA
:.:::    :::.:::::::::::::::::::::::::::: ::::: :::::::::::::::::.::::.:::::.::::: ::::: :: :::::.::
AGCAT---TTGATTGTGAAATACTATGGAAAAGCATCTCATGCTGCTGCTTATCCCTGGGAAGGACTAAACGCATTGGATGCAGCTGTTCTTGCCTACAA
E--H-----L--I--V--K--Y--Y--G--K--A--S--H--A--A--A--Y--P--W--E--G--L--N--A--L--D--A--A--V--L--A--Y--N

-------------------------------------------------><-------------------------------------------------
--N--L--S--V--F--R--Q--Q--M--K--P--T--W--R--V--H--G--I--I--K--N--G--G--V--K--P--N--I--I--P--S--Y--S-
CAATCTGTCTGTGTTCAGACAGCAAATGAAACCAACCTGGAGAGTTCATGGTATAATAAAAAATGGTGGTGTAAAACCCAATATCATTCCCTCTTATTCT
::::::::::::::: :::::.::.::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::
CAATCTGTCTGTGTTAAGACAACAGATGAAACCAACCTGGAGAGTTCAT---ATAATAAAAAATGGTGGTGTAAAACCCAATATCATTCCCTCTTATTCT
--N--L--S--V--L--R--Q--Q--M--K--P--T--W--R--V--H-----I--I--K--N--G--G--V--K--P--N--I--I--P--S--Y--S-

----------------------------------------------------------------------------------------------------
-E--L--I--Y--Y--F--R-----A--P--S--M--K--E--L--Q--V--L--T--K--K--A--E--D--C--F--R--A--A--A--L--A--S--
GAATTAATCTATTACTTCCGT---GCACCCTCAATGAAAGAACTTCAAGTTTTGACCAAAAAGGCAGAAGATTGCTTCAGAGCTGCAGCTTTGGCTTCAG
:::::::::::::::.::::.   :::::::: :::::::::                                                          
GAATTAATCTATTACCTCCGCT--GCACCCTCCATGAAAGAA----------------------------------------------------------
-E--L--I--Y--Y--L--R--\--A--P--S--M--K--E-----------------------------------------------------------

-------><-------------------------------------------------------------------------------------------
G--C--T--V--E--I--K--G--G--A--H--D--Y--Y--N--V--L--P--N--K--S--L--W--K--A--Y--M--E--N--G--R--K--L--G
GGTGCACAGTGGAAATTAAAGGTGGAGCACATGATTATTACAATGTTCTTCCCAATAAGAGCCTATGGAAAGCCTATATGGAAAATGGAAGAAAGCTAGG
        ::.:::::::::: ::::::::::::::::::.::.::::::::::::::::::::.:::::.::.:::.: :::::.::::.::::::.::
--------GTAGAAATTAAAGCTGGAGCACATGATTATTATAACGTTCTTCCCAATAAGAGCCTGTGGAAGGCTTATGTTGAAAACGGAAAAAAGCTGGG
---------V--E--I--K--A--G--A--H--D--Y--Y--N--V--L--P--N--K--S--L--W--K--A--Y--V--E--N--G--K--K--L--G

-------------------------------------------><-------------------------------------------------------
--I--E--F--I--S--E--D--T--M--L--N--G--P--S--G--S--T--D--F--G--N--V--S--F--V--V--P--G--I--H--P--Y--F-
AATAGAGTTCATTTCAGAAGATACAATGTTGAATGGCCCTTCAGGATCTACGGATTTTGGAAATGTTAGTTTTGTGGTTCCTGGAATTCATCCATATTTT
 ::::: :::::::::::::::.::.:::: ::::::::::::   ::::: ::.::::::::::::: :::::::::::::::.:::::::::::::::
CATAGACTTCATTTCAGAAGATGCAGTGTTCAATGGCCCTTCA---TCTACCGACTTTGGAAATGTTACTTTTGTGGTTCCTGGGATTCATCCATATTTT
--I--D--F--I--S--E--D--A--V--F--N--G--P--S-----S--T--D--F--G--N--V--T--F--V--V--P--G--I--H--P--Y--F-

---------------------------------------------------><-----------------------------------------------
-H--I--G--S--N--A--L--N--H--T--E--Q--Y--T--E--A--A--G--S--Q--E--A--Q--F--Y--T--L--R--T--A--K--A--L--
CACATTGGATCTAATGCCTTGAATCATACTGAACAGTACACTGAAGCTGCTGGGTCACAGGAAGCTCAGTTCTACACTCTGCGGACGGCCAAAGCTCTGG
.::::::::::: : :::::::::::::: :::::.::.:::::::::      :::::.:::::::::::::::::..::::.::::::::::: ::::
TACATTGGATCTCAAGCCTTGAATCATACAGAACAATATACTGAAGCT------TCACAAGAAGCTCAGTTCTACACCTTGCGAACGGCCAAAGCGCTGG
-Y--I--G--S--Q--A--L--N--H--T--E--Q--Y--T--E--A--------S--Q--E--A--Q--F--Y--T--L--R--T--A--K--A--L--

----------------------------------------------------------------------------------------------------
A--M--T--A--L--D--V--I--F--K--P--E--L--L--E--G--I--R--E--D--F--K--L--K--L--Q--E--E--Q--F--V--N--A--V
CAATGACGGCACTGGATGTTATTTTTAAACCAGAGTTACTGGAAGGAATCAGAGAGGACTTTAAACTGAAACTTCAAGAAGAACAGTTTGTAAATGCAGT
::::::: :::.::::::::::::::::.::::::::.::.:::..:::::::::::::::::::.:::::::::.::::::: ::::: :::::.::::
CAATGACTGCATTGGATGTTATTTTTAAGCCAGAGTTGCTAGAAAAAATCAGAGAGGACTTTAAATTGAAACTTCGAGAAGAAGAGTTTTTAAATACAGT
A--M--T--A--L--D--V--I--F--K--P--E--L--L--E--K--I--R--E--D--F--K--L--K--L--R--E--E--E--F--L--N--T--V

------>
--E--*-
AGAATAA
:::::::
AGAATAA
--E--*-

Pig Consensus Sequence

>BGISUST0000878575
---------------------------------------------------------------------------------------GGCACGATGAGAC
CCGAAGAGGAGCGGCCCGTGGAGGGGGGCGCCTGCGTCGGCGTCTCCCAGCTGGAGCTGTTGAAGCTGCGCGCCGCGGATTGCATCGACGAAGCGGCCGA
GCGCCTGGGGGCTCTGAGCCGAGCGATCTGGAGCAAGCCGGAGTTGGCCTACGAGGAGCACCATGCCCACGGCGTGCTGACGCGCTTCTTCGAGAGCGAG
CCCCCGGCCGGGTCGTGGGCCGTGCAGCCGCACTACCAGCTGGCCACGGCCTTCCGCGCCGAGTGGGGGCCGCCGCCGCGGGGGTTGGCGGCGACGCGCC
CGCTGCACCTGGGCTTCCTTTGCGAGTACGACGCGCTGCCCGACATCGGGCACGCCTGCGGCCATAACCTAATCGCCGAGGTCGGGGCGGCGGCCGCCCT
GGGTGTGAAGGGGTGCCTGGAGAGCCTCCCTGGGCCGCCTCTGCCGGTGAAGGTAGTTGTCCTGGGAACTCCTGCGGAAGAAGATGGTGGTGGCAAAATT
GATTTAATTGAAGCAGGGGCTTTTACAAATCTTGATGTTGTTTTTATGGCGCATCCATCTCAAGAGAATGCTGCTTATCTACCAGATGCAGCTGAGCAT-
--TTGATTGTGAAATACTATGGAAAAGCATCTCATGCTGCTGCTTATCCCTGGGAAGGACTAAACGCATTGGATGCAGCTGTTCTTGCCTACAACAATCT
GTCTGTGTTAAGACAACAGATGAAACCAACCTGGAGAGTTCAT---ATAATAAAAAATGGTGGTGTAAAACCCAATATCATTCCCTCTTATTCTGAATTA
ATCTATTACCTCCGcgCACCCTCCATGAAAGAA------------------------------------------------------------------G
TAGAAATTAAAGCTGGAGCACATGATTATTATAACGTTCTTCCCAATAAGAGCCTGTGGAAGGCTTATGTTGAAAACGGAAAAAAGCTGGGCATAGACTT
CATTTCAGAAGATGCAGTGTTCAATGGCCCTTCA---TCTACCGACTTTGGAAATGTTACTTTTGTGGTTCCTGGGATTCATCCATATTTTTACATTGGA
TCTCAAGCCTTGAATCATACAGAACAATATACTGAAGCT------TCACAAGAAGCTCAGTTCTACACCTTGCGAACGGCCAAAGCGCTGGCAATGACTG
CATTGGATGTTATTTTTAAGCCAGAGTTGCTAGAAAAAATCAGAGAGGACTTTAAATTGAAACTTCGAGAAGAAGAGTTTTTAAATACAGTAGAATAA


>BGISUSP0000878575
-----------------------------GTMRPEEERPVEGGACVGVSQLELLKLRAADCIDEAAERLGALSRAIWSKPELAYEEHHAHGVLTRFFESE
PPAGSWAVQPHYQLATAFRAEWGPPPRGLAATRPLHLGFLCEYDALPDIGHACGHNLIAEVGAAAALGVKGCLESLPGPPLPVKVVVLGTPAEEDGGGKI
DLIEAGAFTNLDVVFMAHPSQENAAYLPDAAEH-LIVKYYGKASHAAAYPWEGLNALDAAVLAYNNLSVLRQQMKPTWRVH-IIKNGGVKPNIIPSYSEL
IYYLRAPSMKE----------------------VEIKAGAHDYYNVLPNKSLWKAYVENGKKLGIDFISEDAVFNGPS-STDFGNVTFVVPGIHPYFYIG
SQALNHTEQYTEA--SQEAQFYTLRTAKALAMTALDVIFKPELLEKIREDFKLKLREEEFLNTVE*