Sequences
EST Library Info
tra3Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000146856 (click for geneview)
Transcript ID ENST00000275763(link to ensembl)
Symbol NP_848658.1
Localtion Chromosome:7:134128517:134257876:1 band: 7q33
Description hypothetical protein LOC340351
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------><------------------------------------
-M--S--E--D--S--E--K--E--D--Y--S--D--R--T--I--S--D--E--D--E--S--D--E--D--M--F--M--K--F--V--S--E--D--
ATGTCAGAAGATTCAGAAAAGGAAGACTATTCAGACAGAACAATCAGTGATGAAGATGAATCGGATGAGGATATGTTCATGAAATTTGTAAGTGAAGATC
:::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::                                        
ATGTCAGAAGATTCAGAAAAGGAAGACTATTCAGACAGAACAATCAGTGATGAATATGAA----------------------------------------
-M--S--E--D--S--E--K--E--D--Y--S--D--R--T--I--S--D--E--Y--E-----------------------------------------

-----------------------><---------------------------------------------------------------------------
L--H--R--C--A--L--L--T--A--D--S--F--G--D--P--F--F--P--R--T--T--Q--I--L--L--E--Y--Q--L--G--R--W--V--P
TTCATCGGTGTGCACTTTTAACAGCTGACTCTTTTGGTGATCCCTTCTTCCCCCGGACTACACAGATACTATTAGAATATCAGCTAGGGAGATGGGTGCC
                          :::::: ::.::::.:: ::.::::::::::::::.:::::::::::.::.:::::::::::::::::::::::
--------------------------GACTCTATTAGTGACCCATTTTTCCCCCGGACTACGCAGATACTATTGGAGTATCAGCTAGGGAGATGGGTGCC
---------------------------D--S--I--S--D--P--F--F--P--R--T--T--Q--I--L--L--E--Y--Q--L--G--R--W--V--P

----------------------------------------------------------------------------------------------------
--R--L--R--E--P--R--D--L--Y--G--V--S--S--S--G--P--L--S--P--T--R--W--P--Y--H--C--E--V--I--D--E--K--V-
ACGTCTTCGTGAACCAAGGGATTTATATGGTGTCTCTTCTTCTGGTCCATTGAGCCCAACACGGTGGCCATACCATTGTGAAGTCATCGATGAAAAAGTC
:::::::::::::::: :.::.::::::::::::::::::::::::::..:::::::::::::::::::.:::::.:::::.:::::.::::::::::::
ACGTCTTCGTGAACCACGAGACTTATATGGTGTCTCTTCTTCTGGTCCGCTGAGCCCAACACGGTGGCCGTACCACTGTGAGGTCATTGATGAAAAAGTC
--R--L--R--E--P--R--D--L--Y--G--V--S--S--S--G--P--L--S--P--T--R--W--P--Y--H--C--E--V--I--D--E--K--V-

---------><-----------------------------------------------------------------------------------------
-Q--H--I--D--W--T--P--S--C--P--E--P--V--Y--I--P--T--G--L--E--T--E--P--L--Y--P--D--S--K--E--A--T--V--
CAGCATATTGATTGGACTCCTTCTTGTCCTGAGCCAGTGTATATCCCAACGGGCTTAGAAACGGAACCCCTTTATCCAGACTCCAAGGAAGCTACTGTGG
::.::::::                              ::.::::::::.:::.:.::.:.::::::::::::.:::.:::::::::::: ::::::::
CAACATATT------------------------------TACATCCCAACAGGCCTGGAGATGGAACCCCTTTACCCAAACTCCAAGGAAGATACTGTGG
-Q--H--I--------------------------------Y--I--P--T--G--L--E--M--E--P--L--Y--P--N--S--K--E--D--T--V--

-----------------><---------------------------------------------------------------------------------
V--Y--L--A--E--D--A--Y--K--E--P--C--F--V--Y--S--R--V--G--G--N--R--T--P--L--K--Q--P--V--D--Y--R--D--N
TTTATCTAGCTGAAGATGCTTACAAAGAGCCCTGTTTTGTGTATTCCCGAGTTGGGGGTAACCGAACACCTTTGAAGCAGCCTGTGGATTACCGTGACAA
:::::::::::::::::   ::::::::::: ::::::::::::::.:::::::: ::.:::::::::::.:::::::::::.:::::: ::.::::..:
TTTATCTAGCTGAAGAT---TACAAAGAGCCATGTTTTGTGTATTCTCGAGTTGG-GGCAACCGAACACCCTTGAAGCAGCCCGTGGATAACTGTGATGA
V--Y--L--A--E--D-----Y--K--E--P--C--F--V--Y--S--R--V--G--G--N--R--T--P--L--K--Q--P--V--D--N--C--D--D

-----------------------------------------------------------><---------------------------------------
--T--L--M--F--E--A--R--F--E--S--G--N--L--Q--K--V--V--K--V--A--E--Y--E--Y--Q--L--T--V--R--P--D--L--F-
TACTTTGATGTTTGAAGCAAGGTTTGAGAGTGGTAATCTACAGAAGGTAGTCAAAGTGGCAGAATACGAATACCAATTGACTGTACGCCCTGACCTCTTC
::::::::::::::::::::::::::::::::::                        ::::::::.::::::::..:.:::::.::::::::::: :::
TACTTTGATGTTTGAAGCAAGGTTTGAGAGTGGT------------------------GCAGAATATGAATACCAGCTAACTGTGCGCCCTGACCTGTTC
--T--L--M--F--E--A--R--F--E--S--G--------------------------A--E--Y--E--Y--Q--L--T--V--R--P--D--L--F-

----------------------------------------------------------------------------------------------------
-T--N--K--H--T--Q--W--Y--Y--F--Q--V--T--N--M--R--A--G--I--V--Y--R--F--T--I--V--N--F--T--K--P--A--S--
ACAAATAAACACACCCAGTGGTACTATTTCCAAGTCACTAATATGCGAGCAGGAATAGTCTACAGATTCACTATTGTCAACTTCACCAAACCTGCTAGTC
:::::::::::.:: ::::::: ::::::::::::::::::::. :.::::::::::::::::::::::::::::..:::.::::::::.::::::::::
ACAAATAAACATACACAGTGGTTCTATTTCCAAGTCACTAATACCCAAGCAGGAATAGTCTACAGATTCACTATTACCAATTTCACCAAGCCTGCTAGTC
-T--N--K--H--T--Q--W--F--Y--F--Q--V--T--N--T--Q--A--G--I--V--Y--R--F--T--I--T--N--F--T--K--P--A--S--

----------------------------------------------------------------------------------------------------
L--Y--S--R--G--M--R--P--L--F--Y--S--E--K--E--A--K--A--H--H--I--G--W--Q--R--I--G--D--Q--I--K--Y--Y--R
TTTACAGTCGGGGTATGCGCCCACTGTTCTATTCTGAAAAAGAGGCCAAGGCTCATCACATTGGCTGGCAGAGAATAGGAGACCAAATCAAGTATTATAG
::::.:.::::::::::::::::::.::.:::::::::::::::::::: :::::: :..::::::::::::::::::::::::::::::::::::::::
TTTATAATCGGGGTATGCGCCCACTATTTTATTCTGAAAAAGAGGCCAACGCTCATAATGTTGGCTGGCAGAGAATAGGAGACCAAATCAAGTATTATAG
L--Y--N--R--G--M--R--P--L--F--Y--S--E--K--E--A--N--A--H--N--V--G--W--Q--R--I--G--D--Q--I--K--Y--Y--R

----------------------------------------------------------------------------------------------------
--N--N--P--G--Q--D--G--R--H--Y--F--S--L--T--W--T--F--Q--F--P--H--N--K--D--T--C--Y--F--A--H--C--Y--P-
GAACAACCCAGGCCAAGATGGGCGCCATTATTTCTCTCTTACATGGACATTTCAATTTCCACACAACAAAGATACCTGCTACTTTGCTCATTGCTATCCA
.::::::: .:: :::::.:::::::::::::::::::::::.:::::::::::::::::::::::.:::::::::::::::::::::::.:::::::::
AAACAACCAGGGGCAAGACGGGCGCCATTATTTCTCTCTTACGTGGACATTTCAATTTCCACACAATAAAGATACCTGCTACTTTGCTCACTGCTATCCA
--N--N--Q--G--Q--D--G--R--H--Y--F--S--L--T--W--T--F--Q--F--P--H--N--K--D--T--C--Y--F--A--H--C--Y--P-

----------------------------------------------------------------------------------------------------
-Y--T--Y--T--N--L--Q--E--Y--L--S--G--I--N--N--D--P--V--R--S--K--F--C--K--I--R--V--L--C--H--T--L--A--
TACACTTACACCAACCTGCAAGAATACCTTTCTGGCATCAATAATGATCCAGTACGGTCAAAGTTTTGTAAAATACGTGTTTTGTGCCACACGCTTGCTA
:::::::::::::::::::::::::::::::::.:::::::::::::.::::: :::::::::::::::::::: :::::.::::::::::: :: ::.:
TACACTTACACCAACCTGCAAGAATACCTTTCTAGCATCAATAATGACCCAGTTCGGTCAAAGTTTTGTAAAATCCGTGTCTTGTGCCACACTCTGGCCA
-Y--T--Y--T--N--L--Q--E--Y--L--S--S--I--N--N--D--P--V--R--S--K--F--C--K--I--R--V--L--C--H--T--L--A--

----------------------------------------------------------------------------------------------------
R--N--M--V--Y--I--L--T--I--T--T--P--L--K--N--S--D--S--R--K--R--K--A--V--I--L--T--A--R--V--H--P--G--E
GGAACATGGTGTATATTTTAACAATCACTACCCCCTTGAAGAACTCTGACTCAAGAAAGCGGAAGGCTGTGATTCTGACTGCAAGGGTCCATCCAGGGGA
:::::::::::::..:::::::.::..:.:::::::::::::::  :::::::::::::::.::::::::::::.::::::::::::: ::::::::.::
GGAACATGGTGTACGTTTTAACGATTGCCACCCCCTTGAAGAACAATGACTCAAGAAAGCGAAAGGCTGTGATTTTGACTGCAAGGGTACATCCAGGAGA
R--N--M--V--Y--V--L--T--I--A--T--P--L--K--N--N--D--S--R--K--R--K--A--V--I--L--T--A--R--V--H--P--G--E

----------------------------------------------------------------------------------------------------
--T--N--S--S--W--I--M--K--G--F--L--D--Y--I--L--G--N--S--S--D--A--Q--L--L--R--D--T--F--V--F--K--V--V-
AACCAACAGCTCTTGGATCATGAAAGGCTTCCTAGATTATATTTTAGGAAACTCAAGTGATGCACAGTTGCTTCGGGACACTTTTGTCTTCAAGGTGGTA
:::::::::::::::: :::::::.:: :::::::::::::::::::::.::::::::::::::::::::::::::::::::::..::::::::::::::
AACCAACAGCTCTTGGTTCATGAAGGGATTCCTAGATTATATTTTAGGAGACTCAAGTGATGCACAGTTGCTTCGGGACACTTTCATCTTCAAGGTGGTA
--T--N--S--S--W--F--M--K--G--F--L--D--Y--I--L--G--D--S--S--D--A--Q--L--L--R--D--T--F--I--F--K--V--V-

----------------------------------------------------------------------------------------------------
-P--M--L--N--P--D--G--V--I--V--G--N--Y--R--C--S--L--A--G--R--D--L--N--R--N--Y--T--S--L--L--K--E--S--
CCCATGCTCAATCCAGATGGTGTGATTGTGGGAAATTATCGCTGTTCCTTAGCTGGACGGGATTTAAACCGTAATTATACATCTCTCCTGAAGGAATCTT
:::::::: ::::::::::::::::::::.::::::::::: ::::::::::::::::::::::::::::::::.:::::::::::.::::::::::: :
CCCATGCTGAATCCAGATGGTGTGATTGTAGGAAATTATCGGTGTTCCTTAGCTGGACGGGATTTAAACCGTAACTATACATCTCTTCTGAAGGAATCAT
-P--M--L--N--P--D--G--V--I--V--G--N--Y--R--C--S--L--A--G--R--D--L--N--R--N--Y--T--S--L--L--K--E--S--

---------------------------------------><-----------------------------------------------------------
F--P--S--V--W--Y--T--R--N--M--V--H--R--L--M--E--K--R--E--V--I--L--Y--C--D--L--H--G--H--S--R--K--E--N
TTCCTTCTGTATGGTATACCCGGAACATGGTTCATAGACTGATGGAGAAACGAGAGGTTATTTTATACTGTGATCTTCATGGCCATAGTAGGAAAGAGAA
::::::::                                                                                    .:::::::
TTCCTTCT------------------------------------------------------------------------------------GAAGAGAA
F--P--S--------------------------------------------------------------------------------------E--E--N

----------------------------------------------------------------------------------------------------
--I--F--M--Y--G--C--D--G--S--D--R--S--K--T--L--Y--L--Q--Q--R--I--F--P--L--M--L--S--K--N--C--P--D--K-
CATCTTCATGTATGGCTGTGATGGTAGTGACAGATCTAAGACATTATACTTACAGCAACGAATCTTCCCACTTATGCTAAGCAAAAATTGTCCAGATAAA
:::::::::::::::::::::::::.::::.:::: .::..: ::.::.:::::::::::.:::::.::.:::::::: :::::::::::::::::::::
CATCTTCATGTATGGCTGTGATGGTGGTGATAGATGCAAAGCTTTGTATTTACAGCAACGGATCTTTCCGCTTATGCTCAGCAAAAATTGTCCAGATAAA
--I--F--M--Y--G--C--D--G--G--D--R--C--K--A--L--Y--L--Q--Q--R--I--F--P--L--M--L--S--K--N--C--P--D--K-

--><------------------------------------------------------------------------------------------------
-F--S--F--S--A--C--K--F--N--V--Q--K--S--K--E--G--T--G--R--V--V--M--W--K--M--G--I--R--N--S--F--T--M--
TTTTCATTCTCAGCTTGCAAGTTTAATGTCCAGAAGAGCAAAGAAGGAACAGGAAGGGTGGTAATGTGGAAAATGGGAATCAGGAACAGCTTTACCATGG
:::::::::::::::::::::::::::.: ::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::
TTTTCATTCTCAGCTTGCAAGTTTAATATACAGAAGAGCAAAGAAGGAACAGGAAGAGTGGTAATGTGGAAAATGGGAATCAGGAACAGCTTTACCATGG
-F--S--F--S--A--C--K--F--N--I--Q--K--S--K--E--G--T--G--R--V--V--M--W--K--M--G--I--R--N--S--F--T--M--

-----------------------------><---------------------------------------------------------------------
E--A--T--F--C--G--S--T--L--G--N--K--R--G--T--H--F--S--T--K--D--L--E--S--M--G--Y--H--F--C--D--S--L--L
AGGCCACCTTCTGTGGATCTACTCTGGGTAACAAACGAGGCACTCATTTCAGCACGAAAGACCTGGAATCAATGGGATATCATTTTTGTGATTCTCTCTT
:::::::.::::::::::::::.:::   ::.::: ::::::::::.::::..::.::::::.::::.::.:::::::::::::::::::::::::::::
AGGCCACTTTCTGTGGATCTACCCTG---AATAAAAGAGGCACTCACTTCAATACAAAAGACTTGGAGTCGATGGGATATCATTTTTGTGATTCTCTCTT
E--A--T--F--C--G--S--T--L-----N--K--R--G--T--H--F--N--T--K--D--L--E--S--M--G--Y--H--F--C--D--S--L--L

------------------------------><--------------------------------------------------------------------
--D--Y--C--D--P--D--R--T--K--Y--Y--R--C--L--K--E--L--E--E--M--E--R--H--I--T--L--E--K--V--F--E--D--S-
GGATTATTGTGATCCCGACCGGACCAAGTATTATCGGTGCCTGAAAGAATTAGAAGAAATGGAAAGACATATAACCCTGGAAAAAGTCTTTGAGGATTCA
:::.::.:::::::: :::::.::::::                                                                        
GGACTACTGTGATCCAGACCGAACCAAG------------------------------------------------------------------------
--D--Y--C--D--P--D--R--T--K-------------------------------------------------------------------------

-------------------------------------------><---------------------
-D--T--P--V--I--D--I--T--L--D--V--E--S--R--E--L--T--F--L--L--R--*-
GACACACCTGTGATAGACATTACATTGGATGTAGAGTCTAGAGAACTGACATTTTTATTGAGATGA
                                                                  
------------------------------------------------------------------
------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000899225
ATGTCAGAAGATTCAGAAAAGGAAGACTATTCAGACAGAACAATCAGTGATGAATATGAA----------------------------------------
--------------------------GACTCTATTAGTGACCCATTTTTCCCCCGGACTACGCAGATACTATTGGAGTATCAGCTAGGGAGATGGGTGCC
ACGTCTTCGTGAACCACGAGACTTATATGGTGTCTCTTCTTCTGGTCCGCTGAGCCCAACACGGTGGCCGTACCACTGTGAGGTCATTGATGAAAAAGTC
CAACATATT------------------------------TACATCCCAACAGGCCTGGAGATGGAACCCCTTTACCCAAACTCCAAGGAAGATACTGTGG
TTTATCTAGCTGAAGAT---TACAAAGAGCCATGTTTTGTGTATTCTCGAGTtgGCAACCGAACACCCTTGAAGCAGCCCGTGGATAACTGTGATGATAC
TTTGATGTTTGAAGCAAGGTTTGAGAGTGGT------------------------GCAGAATATGAATACCAGCTAACTGTGCGCCCTGACCTGTTCACA
AATAAACATACACAGTGGTTCTATTTCCAAGTCACTAATACCCAAGCAGGAATAGTCTACAGATTCACTATTACCAATTTCACCAAGCCTGCTAGTCTTT
ATAATCGGGGTATGCGCCCACTATTTTATTCTGAAAAAGAGGCCAACGCTCATAATGTTGGCTGGCAGAGAATAGGAGACCAAATCAAGTATTATAGAAA
CAACCAGGGGCAAGACGGGCGCCATTATTTCTCTCTTACGTGGACATTTCAATTTCCACACAATAAAGATACCTGCTACTTTGCTCACTGCTATCCATAC
ACTTACACCAACCTGCAAGAATACCTTTCTAGCATCAATAATGACCCAGTTCGGTCAAAGTTTTGTAAAATCCGTGTCTTGTGCCACACTCTGGCCAGGA
ACATGGTGTACGTTTTAACGATTGCCACCCCCTTGAAGAACAATGACTCAAGAAAGCGAAAGGCTGTGATTTTGACTGCAAGGGTACATCCAGGAGAAAC
CAACAGCTCTTGGTTCATGAAGGGATTCCTAGATTATATTTTAGGAGACTCAAGTGATGCACAGTTGCTTCGGGACACTTTCATCTTCAAGGTGGTACCC
ATGCTGAATCCAGATGGTGTGATTGTAGGAAATTATCGGTGTTCCTTAGCTGGACGGGATTTAAACCGTAACTATACATCTCTTCTGAAGGAATCATTTC
CTTCT------------------------------------------------------------------------------------GAAGAGAACAT
CTTCATGTATGGCTGTGATGGTGGTGATAGATGCAAAGCTTTGTATTTACAGCAACGGATCTTTCCGCTTATGCTCAGCAAAAATTGTCCAGATAAATTT
TCATTCTCAGCTTGCAAGTTTAATATACAGAAGAGCAAAGAAGGAACAGGAAGAGTGGTAATGTGGAAAATGGGAATCAGGAACAGCTTTACCATGGAGG
CCACTTTCTGTGGATCTACCCTG---AATAAAAGAGGCACTCACTTCAATACAAAAGACTTGGAGTCGATGGGATATCATTTTTGTGATTCTCTCTTGGA
CTACTGTGATCCAGACCGAACCAAG---------------------------------------------------------------------------
---------------------------------------------------------------


>BGISUSP0000899225
MSEDSEKEDYSDRTISDEYE----------------------DSISDPFFPRTTQILLEYQLGRWVPRLREPRDLYGVSSSGPLSPTRWPYHCEVIDEKV
QHI----------YIPTGLEMEPLYPNSKEDTVVYLAED-YKEPCFVYSRVGNRTPLKQPVDNCDDTLMFEARFESG--------AEYEYQLTVRPDLFT
NKHTQWFYFQVTNTQAGIVYRFTITNFTKPASLYNRGMRPLFYSEKEANAHNVGWQRIGDQIKYYRNNQGQDGRHYFSLTWTFQFPHNKDTCYFAHCYPY
TYTNLQEYLSSINNDPVRSKFCKIRVLCHTLARNMVYVLTIATPLKNNDSRKRKAVILTARVHPGETNSSWFMKGFLDYILGDSSDAQLLRDTFIFKVVP
MLNPDGVIVGNYRCSLAGRDLNRNYTSLLKESFPS----------------------------EENIFMYGCDGGDRCKALYLQQRIFPLMLSKNCPDKF
SFSACKFNIQKSKEGTGRVVMWKMGIRNSFTMEATFCGSTL-NKRGTHFNTKDLESMGYHFCDSLLDYCDPDRTK-------------------------
---------------------