Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000146859 (click for geneview)
Transcript ID ENST00000275767(link to ensembl)
Symbol NP_060765.1
Localtion Chromosome:7:134290079:134307905:1 band: 7q33
Description hypothetical protein FLJ11000
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--G--P--R--P--R--W--R--D--------Q--L--L--F--M--S--I--I--V--L--V--I--V--V--I--C--L--M--F--Y--A--
ATGGCCGGCCCAAGGCCTCGGTGGCGCGAC------CAGCTGCTGTTCATGAGCATCATAGTCCTCGTGATTGTGGTCATCTGCCTGATGTTTTACGCTC
         :: .  :.. ::::: :  .:      :::::::::::: .:.:::::.:. : :::..:..... ::::::: :::: ::::.::::: :
---------CCCGCCCTCAGGTGGAGGCGCGGCGCCCAGCTGCTGTTCCCGGGCATCGTGCTGCTCACGGCCACCGTCATCTTCCTGCTGTTCTACGCGC
----------P--A--L--R--W--R--R--G--A--Q--L--L--F--P--G--I--V--L--L--T--A--T--V--I--F--L--L--F--Y--A--

----------------------------------------------------------------------------------------------------
L--L--W--E--A--G--N--L--T--D--L--P--N--L--R--I--G--F--Y--N--F--C--L--W--N--E--D--T--S--T--L--Q--C--H
TTCTCTGGGAGGCTGGCAACCTCACTGACCTGCCCAACCTGAGAATCGGCTTCTATAACTTCTGCCTGTGGAATGAGGACACCAGCACCCTACAGTGTCA
:.::::::.::::.:::::::::...:::::::::.::::  :.:::::::::::.::::::::::: :::::.::::.::: .::.::::.:::::..:
TCCTCTGGAAGGCCGGCAACCTCGTCGACCTGCCCGACCTCCGGATCGGCTTCTACAACTTCTGCCTCTGGAACGAGGGCACGGGCGCCCTGCAGTGCTA
L--L--W--K--A--G--N--L--V--D--L--P--D--L--R--I--G--F--Y--N--F--C--L--W--N--E--G--T--G--A--L--Q--C--Y

----------------------------------------------------------------------------------------------------
--Q--F--P--E--L--E--A--L--G--V--P--R--V--G--L--G--L--A--R--L--G--V--Y--G--S--L--V--L--T--L--F--A--P-
CCAGTTCCCTGAGCTGGAAGCCCTGGGGGTGCCTCGGGTTGGCCTGGGCCTGGCCAGGCTTGGCGTGTACGGGTCCCTGGTCCTCACCCTCTTTGCCCCC
:::::::::.:::::::::::::::::::::::.::.:: ::::::: :::::::::::: :::::::::::: :::::::::::::::::::.:. :: 
CCAGTTCCCCGAGCTGGAAGCCCTGGGGGTGCCCCGAGTGGGCCTGGCCCTGGCCAGGCTGGGCGTGTACGGGGCCCTGGTCCTCACCCTCTTCGTGCCG
--Q--F--P--E--L--E--A--L--G--V--P--R--V--G--L--A--L--A--R--L--G--V--Y--G--A--L--V--L--T--L--F--V--P-

----------------------------------------------------------------------------------------------------
-Q--P--L--L--L--A--Q--C--N--S--D--E--R--A--W--R--L--A--V--G--F--L--A--V--S--S--V--L--L--A--G--G--L--
CAGCCTCTCCTCCTAGCCCAGTGCAACAGTGATGAGAGAGCGTGGCGGCTGGCAGTGGGCTTCCTGGCTGTGTCCTCTGTGCTGCTGGCAGGCGGCCTGG
: :::.::::::::.:::..::::::: .: :.:::.::: :::::.::::::.::::::::::::::...: ::::.:.::::::::: .:::::::::
CTGCCCCTCCTCCTGGCCTGGTGCAACCATCACGAGGGAGAGTGGCAGCTGGCGGTGGGCTTCCTGGCCACGGCCTCCGCGCTGCTGGCCAGCGGCCTGG
-L--P--L--L--L--A--W--C--N--H--H--E--G--E--W--Q--L--A--V--G--F--L--A--T--A--S--A--L--L--A--S--G--L--

----------------------------------------------------------------------------------------------------
G--L--F--L--S--Y--V--W--K--W--V--R--L--S--L--P--G--P--G--F--L--A--L--G--S--A--Q--A--L--L--I--L--L--L
GCCTCTTCCTCTCCTATGTGTGGAAGTGGGTCAGGCTCTCCCTCCCGGGGCCTGGGTTTCTAGCTCTGGGCAGCGCCCAGGCCTTACTCATCCTCTTGCT
::::::::::: ::::...:::::::::: :::::::::::::::.::::::.:: :::::::::::::::. .::::::::::::::::::::: .:::
GCCTCTTCCTCACCTACACGTGGAAGTGGCTCAGGCTCTCCCTCCTGGGGCCCGGCTTTCTAGCTCTGGGCGCTGCCCAGGCCTTACTCATCCTCGCGCT
G--L--F--L--T--Y--T--W--K--W--L--R--L--S--L--L--G--P--G--F--L--A--L--G--A--A--Q--A--L--L--I--L--A--L

--------------------------------------------------------------->
--I--A--M--A--V--F--P--L--R--A--E--R--A--E--S--K--L--E--S--C--*-
TATAGCCATGGCTGTGTTCCCTCTGAGGGCTGAGAGGGCTGAGAGCAAGCTTGAGAGCTGCTAA
:::.::::.:::::::::::::: ::::                                    
TATGGCCACGGCTGTGTTCCCTCAGAGG------------------------------------
--M--A--T--A--V--F--P--Q--R-------------------------------------

Pig Consensus Sequence

>BGISUST0000891585
---------CCCGCCCTCAGGTGGAGGCGCGGCGCCCAGCTGCTGTTCCCGGGCATCGTGCTGCTCACGGCCACCGTCATCTTCCTGCTGTTCTACGCGC
TCCTCTGGAAGGCCGGCAACCTCGTCGACCTGCCCGACCTCCGGATCGGCTTCTACAACTTCTGCCTCTGGAACGAGGGCACGGGCGCCCTGCAGTGCTA
CCAGTTCCCCGAGCTGGAAGCCCTGGGGGTGCCCCGAGTGGGCCTGGCCCTGGCCAGGCTGGGCGTGTACGGGGCCCTGGTCCTCACCCTCTTCGTGCCG
CTGCCCCTCCTCCTGGCCTGGTGCAACCATCACGAGGGAGAGTGGCAGCTGGCGGTGGGCTTCCTGGCCACGGCCTCCGCGCTGCTGGCCAGCGGCCTGG
GCCTCTTCCTCACCTACACGTGGAAGTGGCTCAGGCTCTCCCTCCTGGGGCCCGGCTTTCTAGCTCTGGGCGCTGCCCAGGCCTTACTCATCCTCGCGCT
TATGGCCACGGCTGTGTTCCCT---------------------------------


>BGISUSP0000891585
---PALRWRRGAQLLFPGIVLLTATVIFLLFYALLWKAGNLVDLPDLRIGFYNFCLWNEGTGALQCYQFPELEALGVPRVGLALARLGVYGALVLTLFVP
LPLLLAWCNHHEGEWQLAVGFLATASALLASGLGLFLTYTWKWLRLSLLGPGFLALGAAQALLILALMATAVFP-----------