Sequences
CF178136est
rcli17b_g24.y1est
rcad04b_m9.y1est
rnms3606b_g14.y1est
rebs15c_i16.y1est
rnms15_a19.y1est
CO942269est
rhea15_g19.y1est
rjca34c_p13.y1est
rfbs3913b_l1.y1est
rfbs3934b_g11.y1est
rche18_b18.y1est
rnlu1839b_o11.y1est
BI185115est
rmga39_i12.y1est
CF368204est
rcli38b_m23.y1est
CF178771est
BF190532est
DY407328est
rste13_h11.y1est
rcov20b_m4.y1est
rche18_b24.y1est
DY408677est
CF176040est
relu1306b_m3.y1est
rnmm12c_l21.y1est
CK450498est
rplac_10315.y1est
rsme22_f16.y1est
rplac_4717.y1est
reru08c_g9.y1est
AJ668793est
rssp09_e24.y1est
DR082375est
rssp15_k5.y1est
rche25_c21.y1est
CF177394est
rnms3633b_g4.y1est
rebs08c_b12.y1est
rssp05_d14.y1est
BI345797est
DN126506est
rnlu1833b_p13.y1est
CF176095est
rssp17_d5.y1est
relu1302b_n4r1.y1est
rcli31b_d4.y1est
BQ599974est
AW308283est
rcly35b_m15.y1est
rhea08_h24.y1est
rton1210b_g10.y1est
reje09b_f1.y1est
rssp19_j11.y1est
CB481361est
rssp17_h1.y1est
rjej25b_g7.y1est
rnms37_a10.y1est
CF178445est
rhlv23b_m2.y1est
rjej21b_b3.y1est
rpldo0114_c8.y1est
rspc003_h13.y1est
rhlv08b_o19.y1est
rhlv20b_g9.y1est
BX675051est
rcov13b_e1.y1est
CF181339est
rjej15b_b10.y1est
rpan013_a6.y1est
CF180204est
rhea36_c22.y1est
CF368460est
rche31_f21.y1est
rcst12_p13.y1est
rnco1901b_p21.y1est
rcov14b_f1.y1est
rnbm25b_n5.y1est
AJ646996est
rmcp01c_g1.y1est
rcje02_k19.y1est
DY415072est
rsme010_l24.y1est
rfbs3933b_i13.y1est
rfhi4033b_o1.y1est
DN120074est
rcov33b_l12.y1est
CN028836est
rdbla0114_c3.y1est
rcsp34b_k20.y1est
rese26c_p24.y1est
reje33b_f20.y1est
CA779825est
CO954479est
rpgl35_c23.y1est
rhea37_h21.y1est
rcje38_g23.y1est
rnje16c_p18.y1est
AJ955048est
rmcp20c_a15.y1est
rton1208b_a23.y1est
rhlv19b_o8.y1est
rnms25_f2.y1est
rcly30b_a2.y1est
rcbe23_o14.y1est
rfcc17b_l5.y1est
BI182693est
reru07c_o20.y1est
BF442845est
CF367056est
CF177451est
rmcp07c_g16.y1est
rnms03_n22.y1est
rcki10_g11.y1est
DY416409est
CF366791est
rhea02_l21.y1est
EST Library Info
cad2Unavailable
cbe1Cerebellum
che4Heart - RNA from China
cje3Jejunum - RNA from China
cki3Kidney - RNA from China
cli6Liver - RNA from China
cly3Lymph - RNA from China
cov7Ovary - RNA from China
csp2Spleen - RNA from China
cst1Stomach - RNA from China
dbla1Unavailable
ebs3Foetus 50 days, brain stem
eje4Foetus 50 days, jejunum
elu2Foetus 50 days, lung
eru2Foetus 50 days, regio umbilicalis
ese1Foetus 50 days, M. semitendinosus
fbs5Unavailable
fcc2Unavailable
fhi1Unavailable
hea10Heart
hlv5Heart, left ventricle
jca1Joint capsule
jej4Small intestine, jejunum
mcp7Mammae, collostrum producing
mga1Mammary gland - 7 days after weaning
nbm2Newborn 115 days, bone marrow (pelvis)
nco2Newborn 115 days, colon
nje1Newborn 115 days, jejunum
nlu4Newborn 115 days, lung
nmm1Newborn 115 days, mucosal membranes
nms9Newborn 115 days, M. semitendinosus
pan3Pancreas
pgl2Pituitary gland
plac2Unavailable
pldo1Unavailable
relu1Unavailable
sme5M. Semimembranosus
spc1Spinal cord
ssp10M. Supraspinatus
ste1M. Semitendinosus
ton3Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000147684 (click for geneview)
Transcript ID ENST00000276689(link to ensembl)
Symbol NDUFB9
Localtion Chromosome:8:125620525:125631401:1 band: 8q24.13
Description NADH-ubiquinone oxidoreductase B22 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B22) (CI-B22). [Source:Uniprot/SWISSPROT;Acc:Q9Y6M9]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--F--L--A--S--G--P--Y--L--T--H--Q--Q--K--V--L--R--L--Y--K--R--A--L--R--H--L--E--S--W--C--V--Q--
ATGGCGTTCTTGGCGTCGGGACCCTACCTGACCCATCAGCAAAAGGTGTTGCGGCTTTATAAGCGGGCGCTACGCCACCTCGAGTCGTGGTGCGTCCAGA
::::: ::::.::::.::: . :::::::::::::.:::::.::::::.::::::::::::::::::::::.:::::::: :::::::::::::::    
ATGGCTTTCTCGGCGCCGGCGGCCTACCTGACCCACCAGCAGAAGGTGCTGCGGCTTTATAAGCGGGCGCTGCGCCACCTGGAGTCGTGGTGCGTC----
-M--A--F--S--A--P--A--A--Y--L--T--H--Q--Q--K--V--L--R--L--Y--K--R--A--L--R--H--L--E--S--W--C--V-----

><--------------------------------------------------------------------------------------------------
R--D--K--Y--R--Y--F--A--C--L--M--R--A--R--F--E--E--H--K--N--E--K--D--M--A--K--A--T--Q--L--L--K--E--A
GAGACAAATACCGATACTTTGCTTGTTTGATGAGAGCCCGGTTTGAAGAACATAAGAATGAAAAGGATATGGCGAAGGCCACCCAGCTGCTGAAGGAGGC
  :::::::::::.::::::::::::::::::::::::::.::::: :::::.:::::::::::::::::::.::::::::::::::::::::.: ::::
--GACAAATACCGGTACTTTGCTTGTTTGATGAGAGCCCGATTTGATGAACACAAGAATGAAAAGGATATGGTGAAGGCCACCCAGCTGCTGAGGCAGGC
---D--K--Y--R--Y--F--A--C--L--M--R--A--R--F--D--E--H--K--N--E--K--D--M--V--K--A--T--Q--L--L--R--Q--A

---------------------------------------------------------------------------------------------><-----
--E--E--E--F--W--Y--R--Q--H--P--Q--P--Y--I--F--P--D--S--P--G--G--T--S--Y--E--R--Y--D--C--Y--K--V--P-
CGAGGAAGAATTCTGGTACCGTCAGCATCCACAGCCATACATCTTCCCTGACTCTCCTGGGGGCACCTCCTATGAGAGATACGATTGCTACAAGGTCCCA
::::::.:::::::::::: :::::::.:: :::::::::::::::::.:: ::::::::::::::::::::.::::::::::: ::.::::::::.:: 
CGAGGAGGAATTCTGGTACGGTCAGCACCCTCAGCCATACATCTTCCCCGAGTCTCCTGGGGGCACCTCCTACGAGAGATACGAGTGTTACAAGGTTCCT
--E--E--E--F--W--Y--G--Q--H--P--Q--P--Y--I--F--P--E--S--P--G--G--T--S--Y--E--R--Y--E--C--Y--K--V--P-

----------------------------------------------------------------------------------------------------
-E--W--C--L--D--D--W--H--P--S--E--K--A--M--Y--P--D--Y--F--A--K--R--E--Q--W--K--K--L--R--R--E--S--W--
GAATGGTGCTTAGATGACTGGCATCCTTCTGAGAAGGCAATGTATCCTGATTACTTTGCCAAGAGAGAACAGTGGAAGAAACTGCGGAGGGAAAGCTGGG
::.::::::::::::::::::::::::::::::::.:: :::::::::::::::::::::::::::::.::::::::::.::: :::::.::::::::::
GAGTGGTGCTTAGATGACTGGCATCCTTCTGAGAAAGCCATGTATCCTGATTACTTTGCCAAGAGAGAGCAGTGGAAGAGACTTCGGAGAGAAAGCTGGG
-E--W--C--L--D--D--W--H--P--S--E--K--A--M--Y--P--D--Y--F--A--K--R--E--Q--W--K--R--L--R--R--E--S--W--

-------><-------------------------------------------------------------------------------------------
E--R--E--V--K--Q--L--Q--E--E--T--P--P--G--G--P--L--T--E--A--L--P--P--A--R--K--E--G--D--L--P--P--L--W
AACGAGAGGTTAAGCAGCTGCAGGAGGAAACGCCACCTGGTGGTCCTTTAACTGAAGCTTTGCCCCCTGCCCGAAAGGAAGGTGATTTGCCCCCACTGTG
:.::::::::::::::::::::::::::::: ::::::::.:::::.  :::::::::::::::.:: ::::::::::::::::::::::::::::::::
AGCGAGAGGTTAAGCAGCTGCAGGAGGAAACCCCACCTGGCGGTCCCAGAACTGAAGCTTTGCCTCCAGCCCGAAAGGAAGGTGATTTGCCCCCACTGTG
E--R--E--V--K--Q--L--Q--E--E--T--P--P--G--G--P--R--T--E--A--L--P--P--A--R--K--E--G--D--L--P--P--L--W

--------------------------------------->
--W--Y--I--V--T--R--P--R--E--R--P--M--*-
GTGGTATATTGTGACCAGACCCCGGGAGCGGCCCATGTAG
::::.:::::::::::::.:::::.::.::::::::::::
GTGGCATATTGTGACCAGGCCCCGAGAACGGCCCATGTAG
--W--H--I--V--T--R--P--R--E--R--P--M--*-

Pig Consensus Sequence

>BGISUST0000901900
ATGGCTTTCTCGGCGCCGGCGGCCTACCTGACCCACCAGCAGAAGGTGCTGCGGCTTTATAAGCGGGCGCTGCGCCACCTGGAGTCGTGGTGCGTC----
--GACAAATACCGGTACTTTGCTTGTTTGATGAGAGCCCGATTTGATGAACACAAGAATGAAAAGGATATGGTGAAGGCCACCCAGCTGCTGAGGCAGGC
CGAGGAGGAATTCTGGTACGGTCAGCACCCTCAGCCATACATCTTCCCCGAGTCTCCTGGGGGCACCTCCTACGAGAGATACGAGTGTTACAAGGTTCCT
GAGTGGTGCTTAGATGACTGGCATCCTTCTGAGAAAGCCATGTATCCTGATTACTTTGCCAAGAGAGAGCAGTGGAAGAGACTTCGGAGAGAAAGCTGGG
AGCGAGAGGTTAAGCAGCTGCAGGAGGAAACCCCACCTGGCGGTCCCAGAACTGAAGCTTTGCCTCCAGCCCGAAAGGAAGGTGATTTGCCCCCACTGTG
GTGGCATATTGTGACCAGGCCCCGAGAACGGCCCATGTAG


>BGISUSP0000901900
MAFSAPAAYLTHQQKVLRLYKRALRHLESWCV--DKYRYFACLMRARFDEHKNEKDMVKATQLLRQAEEEFWYGQHPQPYIFPESPGGTSYERYECYKVP
EWCLDDWHPSEKAMYPDYFAKREQWKRLRRESWEREVKQLQEETPPGGPRTEALPPARKEGDLPPLWWHIVTRPRERPM*