Sequences
EST Library Info
eje2Foetus 50 days, jejunum
mgp1Mammary gland - 7 days pre birth
Clusters
Oligos
SNPs

Gene ID ENSG00000148522 (click for geneview)
Transcript ID ENST00000277685(link to ensembl)
Localtion Chromosome:10:29227937:29228422:-1 band: 10p12.1
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-K--V--T--N--T--K--R--K--R--R--G--T--R--Y--M--F--F--R--P--F--R--K--H--G--V--V--P--L--A--T--Y--M--R--
AAAGTGACGAACACAAAGAGAAAGAGGAGGGGCACCCGATATATGTTCTTTAGGCCTTTTAGAAAACATGGAGTTGTTCCTTTGGCCACATATATGCGAA
:::.::::.:::::.:::.::::::::::::::::::: ::::::::::.: ::::::::::::::::::::::.::::: :::::::::::.:::::::
AAAATGACAAACACGAAGGGAAAGAGGAGGGGCACCCGCTATATGTTCTCTCGGCCTTTTAGAAAACATGGAGTCGTTCC-TTGGCCACATACATGCGAA
-K--M--T--N--T--K--G--K--R--R--G--T--R--Y--M--F--S--R--P--F--R--K--H--G--V--V--P--L--A--T--Y--M--R--

----------------------------------------------------------------------------------------------------
I--Y--K--K--G--D--I--V--D--I--K--G--M--G--T--V--Q--K--G--M--P--H--K--C--Y--H--G--K--T--G--R--V--Y--N
TCTATAAGAAAGGTGATATTGTAGACATCAAGGGAATGGGTACTGTTCAAAAAGGAATGCCCCACAAGTGTTACCATGGCAAAACTGGAAGAGTCTACAA
::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TCTACAAGAAAGGTGATATTGTAGACATCAAGGGAATGGGCACTGTTCAAAAAGGAATGCCCCACAAGTGTTACCATGGCAAAACTGGAAGAGTCTACAA
I--Y--K--K--G--D--I--V--D--I--K--G--M--G--T--V--Q--K--G--M--P--H--K--C--Y--H--G--K--T--G--R--V--Y--N

----------------------------------------------------------------------------------------------------
--V--T--Q--H--A--V--G--I--V--V--N--T--Q--V--K--G--K--I--L--A--K--R--I--N--V--F--I--E--H--I--K--H--S-
TGTTACCCAGCATGCTGTTGGCATTGTTGTAAACACACAAGTTAAGGGCAAGATTCTTGCCAAGAGAATTAATGTGTTTATTGAGCACATTAAGCACTCT
::: ::::::::::::::::::::::::::::::: :::.::::::::::::::::::::::::::::::::::::. :::.:::::.::.::.::::::
TGTAACCCAGCATGCTGTTGGCATTGTTGTAAACAAACAGGTTAAGGGCAAGATTCTTGCCAAGAGAATTAATGTGCGTATCGAGCATATCAAACACTCT
--V--T--Q--H--A--V--G--I--V--V--N--K--Q--V--K--G--K--I--L--A--K--R--I--N--V--R--I--E--H--I--K--H--S-

----------------------------------------------------------------------------------------------------
-K--S--R--D--S--F--L--K--R--M--K--E--N--D--Q--K--K--K--E--A--K--E--K--G--T--W--V--Q--L--K--R--Q--P--
AAGAGCCGAGACAGCTTCCTGAAACGCATGAAGGAAAATGATCAGAAAAAGAAAGAAGCCAAAGAGAAAGGTACCTGGGTTCAACTAAAGCGCCAGCCTG
::::::::::::::::::::::::::..::::::::::.::::::::::::::.::::::::::::::::: ::.::::::::.::.:::::::::::::
AAGAGCCGAGACAGCTTCCTGAAACGTGTGAAGGAAAACGATCAGAAAAAGAAGGAAGCCAAAGAGAAAGGGACTTGGGTTCAGCTGAAGCGCCAGCCTG
-K--S--R--D--S--F--L--K--R--V--K--E--N--D--Q--K--K--K--E--A--K--E--K--G--T--W--V--Q--L--K--R--Q--P--

--------------------------------------------------------------------------------------
A--P--P--R--E--A--H--F--V--R--T--N--G--K--E--P--E--L--L--E--P--I--P--Y--E--F--M--A--*-
CTCCACCCAGAGAAGCACACTTTGTGAGAACCAATGGGAAGGAGCCTGAGCTGCTGGAACCTATTCCCTATGAATTCATGGCATAA
:::::::::::::::: :::::.:::::::::::.::.:::::::::::.:::.:::::::.:::::.::::::::::::::::.:
CTCCACCCAGAGAAGCTCACTTCGTGAGAACCAACGGAAAGGAGCCTGAACTGTTGGAACCCATTCCTTATGAATTCATGGCATGA
A--P--P--R--E--A--H--F--V--R--T--N--G--K--E--P--E--L--L--E--P--I--P--Y--E--F--M--A--*-

Pig Consensus Sequence

>BGISUST0000884904
AAAATGACAAACACGAAGGGAAAGAGGAGGGGCACCCGCTATATGTTCTCTCGGCCTTTTAGAAAACATGGAGTCGTttTGGCCACATACATGCGAATCT
ACAAGAAAGGTGATATTGTAGACATCAAGGGAATGGGCACTGTTCAAAAAGGAATGCCCCACAAGTGTTACCATGGCAAAACTGGAAGAGTCTACAATGT
AACCCAGCATGCTGTTGGCATTGTTGTAAACAAACAGGTTAAGGGCAAGATTCTTGCCAAGAGAATTAATGTGCGTATCGAGCATATCAAACACTCTAAG
AGCCGAGACAGCTTCCTGAAACGTGTGAAGGAAAACGATCAGAAAAAGAAGGAAGCCAAAGAGAAAGGGACTTGGGTTCAGCTGAAGCGCCAGCCTGCTC
CACCCAGAGAAGCTCACTTCGTGAGAACCAACGGAAAGGAGCCTGAACTGTTGGAACCCATTCCTTATGAATTCATGGCATGA


>BGISUSP0000884904
KMTNTKGKRRGTRYMFSRPFRKHGVVLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSK
SRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPELLEPIPYEFMA*