Sequences
EST Library Info
cad1Unavailable
nbm1Newborn 115 days, bone marrow (pelvis)
nmm2Newborn 115 days, mucosal membranes
Clusters
Oligos
SNPs

Gene ID ENSG00000148908 (click for geneview)
Transcript ID ENST00000278155(link to ensembl)
Symbol RGS10
Localtion Chromosome:10:121249442:121292157:-1 band: 10q26.11
Description Regulator of G-protein signaling 10 (RGS10). [Source:Uniprot/SWISSPROT;Acc:O43665]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------><--------------------------------------------------
-M--F--N--R--A--V--S--R--L--S--R--K--R--P--P--S--D--I--H--D--S--D--G--S--S--S--S--S--H--Q--S--L--K--
ATGTTCAACCGCGCCGTGAGCCGGCTGAGCAGGAAGCGGCCGCCGTCAGACATCCACGACAGCGATGGCAGTTCCAGCAGCAGCCACCAGAGCCTCAAGA
:::::.::::::::.:::::::::::::::::::::::::::::::::   :::::::::::.::::: ::: ::::::::::::::::::.::.:::::
ATGTTTAACCGCGCTGTGAGCCGGCTGAGCAGGAAGCGGCCGCCGTCA---ATCCACGACAGTGATGGGAGTGCCAGCAGCAGCCACCAGAACCCCAAGA
-M--F--N--R--A--V--S--R--L--S--R--K--R--P--P--S-----I--H--D--S--D--G--S--A--S--S--S--H--Q--N--P--K--

-------------------------------------------------------------------><-------------------------------
S--T--A--K--W--A--A--S--L--E--N--L--L--E--D--P--E--G--V--K--R--F--R--E--F--L--K--K--E--F--S--E--E--N
GCACAGCCAAATGGGCGGCATCCCTGGAGAATCTGCTGGAAGACCCAGAAGGCGTGAAAAGATTTAGGGAATTTTTAAAAAAGGAATTCAGTGAAGAAAA
::::::::::.:::::::: ::..::::::::::.:: ::::::::::::::::::::::::::::::::.:::::::::::.::::::::::::::.::
GCACAGCCAAGTGGGCGGCTTCTTTGGAGAATCTACTTGAAGACCCAGAAGGCGTGAAAAGATTTAGGGAGTTTTTAAAAAAAGAATTCAGTGAAGAGAA
S--T--A--K--W--A--A--S--L--E--N--L--L--E--D--P--E--G--V--K--R--F--R--E--F--L--K--K--E--F--S--E--E--N

------------------------------------------------------><--------------------------------------------
--V--L--F--W--L--A--C--E--D--F--K--K--M--Q--D--K--T--Q--M--Q--E--K--A--K--E--I--Y--M--T--F--L--S--S-
TGTTTTGTTTTGGCTAGCATGTGAAGATTTTAAGAAAATGCAAGATAAGACGCAGATGCAGGAAAAGGCAAAGGAGATCTACATGACCTTTCTGTCCAGC
:::::::::::::::::: :::::::::::::::::::..::::::::.: ::::::::::::::::::::::::::: :::::::::::::::::::::
TGTTTTGTTTTGGCTAGCCTGTGAAGATTTTAAGAAAACACAAGATAAAAAGCAGATGCAGGAAAAGGCAAAGGAGATATACATGACCTTTCTGTCCAGC
--V--L--F--W--L--A--C--E--D--F--K--K--T--Q--D--K--K--Q--M--Q--E--K--A--K--E--I--Y--M--T--F--L--S--S-

--------------------------------------------------------------------------------------------------><
-K--A--S--S--Q--V--N--V--E--G--Q--S--R--L--N--E--K--I--L--E--E--P--H--P--L--M--F--Q--K--L--Q--D--Q--
AAGGCCTCATCACAGGTCAACGTGGAGGGGCAGTCTCGGCTCAACGAGAAGATCCTGGAAGAACCGCACCCTCTGATGTTCCAGAAACTCCAGGACCAGA
::::::::::::::.:::::.:: ::::: :::::.::::::::.::::::::.:::::.:::::.::::: :::::::::::.::::::::::::::::
AAGGCCTCATCACAAGTCAATGTTGAGGGCCAGTCCCGGCTCAATGAGAAGATTCTGGAGGAACCACACCCACTGATGTTCCAAAAACTCCAGGACCAGA
-K--A--S--S--Q--V--N--V--E--G--Q--S--R--L--N--E--K--I--L--E--E--P--H--P--L--M--F--Q--K--L--Q--D--Q--

----------------------------------------------------------------------------------------------------
I--F--N--L--M--K--Y--D--S--Y--S--R--F--L--K--S--D--L--F--L--K--H--K--R--T--E--E--E--E--E--D--L--P--D
TCTTTAATCTCATGAAGTACGACAGCTACAGCCGCTTCTTAAAGTCTGACTTGTTTTTAAAACACAAGCGAACCGAGGAAGAGGAAGAAGATTTGCCTGA
::::.::.:::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::: :::::::.  :.::
TCTTCAACCTCATGAAGTATGACAGCTACAGCCGCTTCTTAAAGTCTGACTTGTTCTTAAAACACAAGCGAACCGAGGAAGAGGATGAAGATTCCACCGA
I--F--N--L--M--K--Y--D--S--Y--S--R--F--L--K--S--D--L--F--L--K--H--K--R--T--E--E--E--D--E--D--S--T--D

--------------------------------------------->
--A--Q--T--A--A--K--R--A--S--R--I--Y--N--T--*-
TGCTCAAACTGCAGCTAAAAGAGCTTCCAGAATTTATAACACATGA
:::.::.:::::.:::::: ::::::: :::::::::::.::::::
TGCCCAGACTGCGGCTAAACGAGCTTCGAGAATTTATAATACATGA
--A--Q--T--A--A--K--R--A--S--R--I--Y--N--T--*-

Pig Consensus Sequence

>BGISUST0000878581
ATGTTTAACCGCGCTGTGAGCCGGCTGAGCAGGAAGCGGCCGCCGTCA---ATCCACGACAGTGATGGGAGTGCCAGCAGCAGCCACCAGAACCCCAAGA
GCACAGCCAAGTGGGCGGCTTCTTTGGAGAATCTACTTGAAGACCCAGAAGGCGTGAAAAGATTTAGGGAGTTTTTAAAAAAAGAATTCAGTGAAGAGAA
TGTTTTGTTTTGGCTAGCCTGTGAAGATTTTAAGAAAACACAAGATAAAAAGCAGATGCAGGAAAAGGCAAAGGAGATATACATGACCTTTCTGTCCAGC
AAGGCCTCATCACAAGTCAATGTTGAGGGCCAGTCCCGGCTCAATGAGAAGATTCTGGAGGAACCACACCCACTGATGTTCCAAAAACTCCAGGACCAGA
TCTTCAACCTCATGAAGTATGACAGCTACAGCCGCTTCTTAAAGTCTGACTTGTTCTTAAAACACAAGCGAACCGAGGAAGAGGATGAAGATTCCACCGA
TGCCCAGACTGCGGCTAAACGAGCTTCGAGAATTTATAATACATGA


>BGISUSP0000878581
MFNRAVSRLSRKRPPS-IHDSDGSASSSHQNPKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKTQDKKQMQEKAKEIYMTFLSS
KASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEDEDSTDAQTAAKRASRIYNT*