Sequences
EST Library Info
cki1Kidney - RNA from China
cly1Lymph - RNA from China
csp1Spleen - RNA from China
cst1Stomach - RNA from China
elu1Foetus 50 days, lung
ese2Foetus 50 days, M. semitendinosus
lnt1Lymphatic nodule tracheobroncalis
plac3Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000149397 (click for geneview)
Transcript ID ENST00000278715(link to ensembl)
Symbol HMBS
Localtion Chromosome:11:118460803:118469467:1 band: 11q23.3
Description Porphobilinogen deaminase (EC 2.5.1.61) (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) (PBG-D). [Source:Uniprot/SWISSPROT;Acc:P08397]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------><----------------------------------------------------><------------
-M--S--G--N--G--N--A--A--A--T--A--E--E--N--S--P--K--M--R--V--I--R--V--G--T--R--K--S--Q--L--A--R--I--
ATGTCTGGTAACGGCAATGCGGCTGCAACGGCGGAAGAAAACAGCCCAAAGATGAGAGTGATTCGCGTGGGTACCCGCAAGAGCCAGCTTGCTCGCATAC
                                 ::::::::::::::::::::::::::::::::.::::::::::::::.:::::::: ::.:::::::
---------------------------------GAAGAAAACAGCCCAAAGATGAGAGTGATTCGTGTGGGTACCCGCAAAAGCCAGCTGGCCCGCATAC
----------------------------------E--E--N--S--P--K--M--R--V--I--R--V--G--T--R--K--S--Q--L--A--R--I--

-----------------------------------------------------------><---------------------------------------
Q--T--D--S--V--V--A--T--L--K--A--S--Y--P--G--L--Q--F--E--I--I--A--M--S--T--T--G--D--K--I--L--D--T--A
AGACGGACAGTGTGGTGGCAACATTGAAAGCCTCGTACCCTGGCCTGCAGTTTGAAATCATTGCTATGTCCACCACAGGGGACAAGATTCTTGATACTGC
:.::::::::::::::::::::..:::::::::..::::: ::::::::::::::::::   :::::::::::::::::::::::::::::.::.:::::
AAACGGACAGTGTGGTGGCAACGCTGAAAGCCTTATACCCAGGCCTGCAGTTTGAAATC---GCTATGTCCACCACAGGGGACAAGATTCTCGACACTGC
Q--T--D--S--V--V--A--T--L--K--A--L--Y--P--G--L--Q--F--E--I-----A--M--S--T--T--G--D--K--I--L--D--T--A

---------><------------------------------------------------------><---------------------------------
--L--S--K--I--G--E--K--S--L--F--T--K--E--L--E--H--A--L--E--K--N--E--V--D--L--V--V--H--S--L--K--D--L-
ACTCTCTAAGATTGGAGAGAAAAGCCTGTTTACCAAGGAGCTTGAACATGCCCTGGAGAAGAATGAAGTGGACCTGGTTGTTCACTCCTTGAAGGACCTG
:::.:::::::::::::::::.:::::::::::::::::::: :::::.:: :::::::.::::   :::::::::::::::::.:::.: :::::::::
ACTTTCTAAGATTGGAGAGAAGAGCCTGTTTACCAAGGAGCTGGAACACGCGCTGGAGAGGAAT---GTGGACCTGGTTGTTCATTCCCTCAAGGACCTG
--L--S--K--I--G--E--K--S--L--F--T--K--E--L--E--H--A--L--E--R--N-----V--D--L--V--V--H--S--L--K--D--L-

-------------------------------------------><-------------------------------------------------------
-P--T--V--L--P--P--G--F--T--I--G--A--I--C--K--R--E--N--P--H--D--A--V--V--F--H--P--K--F--V--G--K--T--
CCCACTGTGCTTCCTCCTGGCTTCACCATCGGAGCCATCTGCAAGCGGGAAAACCCTCATGATGCTGTTGTCTTTCACCCAAAATTTGTTGGGAAGACCC
::::: :::::::::::::::::::::::.::::::.:::::   ::.::. .:::..:::::::::::::::::::::: ::::::::.::::::::::
CCCACGGTGCTTCCTCCTGGCTTCACCATTGGAGCCGTCTGC---CGAGAGTGCCCCTATGATGCTGTTGTCTTTCACCCCAAATTTGTCGGGAAGACCC
-P--T--V--L--P--P--G--F--T--I--G--A--V--C-----R--E--C--P--Y--D--A--V--V--F--H--P--K--F--V--G--K--T--

---------------------><--------------------------------------------------------------------------><-
L--E--T--L--P--E--K--S--V--V--G--T--S--S--L--R--R--A--A--Q--L--Q--R--K--F--P--H--L--E--F--R--S--I--R
TAGAAACCCTGCCAGAGAAGAGTGTGGTGGGAACCAGCTCCCTGCGAAGAGCAGCCCAGCTGCAGAGAAAGTTCCCGCATCTGGAGTTCAGGAGTATTCG
::::::::.:::::::::::   :::::.:::::::::::::::::.:::::.:::::::: ::::::::::::::.:::::::::::::.::::   ::
TAGAAACCTTGCCAGAGAAG---GTGGTAGGAACCAGCTCCCTGCGGAGAGCGGCCCAGCTTCAGAGAAAGTTCCCACATCTGGAGTTCAAGAGT---CG
L--E--T--L--P--E--K-----V--V--G--T--S--S--L--R--R--A--A--Q--L--Q--R--K--F--P--H--L--E--F--K--S-----R

----------------------------------------------------------------------------------------------------
--G--N--L--N--T--R--L--R--K--L--D--E--Q--Q--E--F--S--A--I--I--L--A--T--A--G--L--Q--R--M--G--W--H--N-
GGGAAACCTCAACACCCGGCTTCGGAAGCTGGACGAGCAGCAGGAGTTCAGTGCCATCATCCTGGCAACAGCTGGCCTGCAGCGCATGGGCTGGCACAAC
::::::::::::::: :::::::::::::::::.:::: ::::::::::::::::::::::::::: .:::::::::::::::::::::: ::::: :::
GGGAAACCTCAACACACGGCTTCGGAAGCTGGATGAGCTGCAGGAGTTCAGTGCCATCATCCTGGCTGCAGCTGGCCTGCAGCGCATGGGGTGGCAGAAC
--G--N--L--N--T--R--L--R--K--L--D--E--L--Q--E--F--S--A--I--I--L--A--A--A--G--L--Q--R--M--G--W--Q--N-

-----------><-------------------------------------><------------------------------------------------
-R--V--G--Q--I--L--H--P--E--E--C--M--Y--A--V--G--Q--G--A--L--G--V--E--V--R--A--K--D--Q--D--I--L--D--
CGGGTGGGGCAGATCCTGCACCCTGAGGAATGCATGTATGCTGTGGGCCAGGGGGCCTTGGGCGTGGAAGTGCGAGCCAAGGACCAGGACATCTTGGATC
::::::::.:::                                       ::::::.::::::::::::: :::::::::::::::::::::.::::::
CGGGTGGGACAG---------------------------------------GGGGCCCTGGGCGTGGAAGTCCGAGCCAAGGACCAGGACATCCTGGATC
-R--V--G--Q-----------------------------------------G--A--L--G--V--E--V--R--A--K--D--Q--D--I--L--D--

----------------------------------------------------------------------><----------------------------
L--V--G--V--L--H--D--P--E--T--L--L--R--C--I--A--E--R--A--F--L--R--H--L--E--G--G--C--S--V--P--V--A--V
TGGTGGGTGTGCTGCACGATCCCGAGACTCTGCTTCGCTGCATCGCTGAAAGGGCCTTCCTGAGGCACCTGGAAGGAGGCTGCAGTGTGCCAGTAGCCGT
:::::::::::.::::.:::::.::::::::::::::::::::.:::::: : :::::::::::::::::::::::::::::::::::::::::::: ::
TGGTGGGTGTGTTGCATGATCCTGAGACTCTGCTTCGCTGCATTGCTGAACGCGCCTTCCTGAGGCACCTGGAAGGAGGCTGCAGTGTGCCAGTAGCAGT
L--V--G--V--L--H--D--P--E--T--L--L--R--C--I--A--E--R--A--F--L--R--H--L--E--G--G--C--S--V--P--V--A--V

------------------------><--------------------------------------------------------------------------
--H--T--A--M--K--D--G--Q--L--Y--L--T--G--G--V--W--S--L--D--G--S--D--S--I--Q--E--T--M--Q--A--T--I--H-
GCATACAGCTATGAAGGATGGGCAACTGTACCTGACTGGAGGAGTCTGGAGTCTAGACGGCTCAGATAGCATACAAGAGACCATGCAGGCTACCATCCAT
::::::::::::::::::::::::::: ::::::::::::::::::::::::::..:.::. :::: :::::.::::::::.::::::::.:::::::::
GCATACAGCTATGAAGGATGGGCAACTCTACCTGACTGGAGGAGTCTGGAGTCTGAATGGTGCAGAGAGCATGCAAGAGACTATGCAGGCCACCATCCAT
--H--T--A--M--K--D--G--Q--L--Y--L--T--G--G--V--W--S--L--N--G--A--E--S--M--Q--E--T--M--Q--A--T--I--H-

-----------><---------------------------------------------------------------------------------------
-V--P--A--Q--H--E--D--G--P--E--D--D--P--Q--L--V--G--I--T--A--R--N--I--P--R--G--P--Q--L--A--A--Q--N--
GTCCCTGCCCAGCATGAAGATGGCCCTGAGGATGACCCACAGTTGGTAGGCATCACTGCTCGTAACATTCCACGAGGGCCCCAGTTGGCTGCCCAGAACT
::::::::.:::::.:::::::::::::::::::::::::::.: ::.:::::::::::.:: ::.::::: ::::.. ::::..:::::::. :::::.
GTCCCTGCTCAGCACGAAGATGGCCCTGAGGATGACCCACAGCTTGTGGGCATCACTGCCCGGAATATTCCTCGAGAAGCCCAACTGGCTGCTGAGAACC
-V--P--A--Q--H--E--D--G--P--E--D--D--P--Q--L--V--G--I--T--A--R--N--I--P--R--E--A--Q--L--A--A--E--N--

------------------------------------------------------------------------------------->
L--G--I--S--L--A--N--L--L--L--S--K--G--A--K--N--I--L--D--V--A--R--Q--L--N--D--A--H--*-
TGGGCATCAGCCTGGCCAACTTGTTGCTGAGCAAAGGAGCCAAAAACATCCTGGATGTTGCACGGCAGCTTAACGATGCCCATTAA
:::::::::::::::::: ::::.::::::.:::::: :::::.:::::::::::::::::::::::.::.::.::::::::.:::
TGGGCATCAGCCTGGCCACCTTGCTGCTGAACAAAGGTGCCAAGAACATCCTGGATGTTGCACGGCAACTCAATGATGCCCACTAA
L--G--I--S--L--A--T--L--L--L--N--K--G--A--K--N--I--L--D--V--A--R--Q--L--N--D--A--H--*-

Pig Consensus Sequence

>BGISUST0000900352
---------------------------------GAAGAAAACAGCCCAAAGATGAGAGTGATTCGTGTGGGTACCCGCAAAAGCCAGCTGGCCCGCATAC
AAACGGACAGTGTGGTGGCAACGCTGAAAGCCTTATACCCAGGCCTGCAGTTTGAAATC---GCTATGTCCACCACAGGGGACAAGATTCTCGACACTGC
ACTTTCTAAGATTGGAGAGAAGAGCCTGTTTACCAAGGAGCTGGAACACGCGCTGGAGAGGAAT---GTGGACCTGGTTGTTCATTCCCTCAAGGACCTG
CCCACGGTGCTTCCTCCTGGCTTCACCATTGGAGCCGTCTGC---CGAGAGTGCCCCTATGATGCTGTTGTCTTTCACCCCAAATTTGTCGGGAAGACCC
TAGAAACCTTGCCAGAGAAG---GTGGTAGGAACCAGCTCCCTGCGGAGAGCGGCCCAGCTTCAGAGAAAGTTCCCACATCTGGAGTTCAAGAGT---CG
GGGAAACCTCAACACACGGCTTCGGAAGCTGGATGAGCTGCAGGAGTTCAGTGCCATCATCCTGGCTGCAGCTGGCCTGCAGCGCATGGGGTGGCAGAAC
CGGGTGGGACAG---------------------------------------GGGGCCCTGGGCGTGGAAGTCCGAGCCAAGGACCAGGACATCCTGGATC
TGGTGGGTGTGTTGCATGATCCTGAGACTCTGCTTCGCTGCATTGCTGAACGCGCCTTCCTGAGGCACCTGGAAGGAGGCTGCAGTGTGCCAGTAGCAGT
GCATACAGCTATGAAGGATGGGCAACTCTACCTGACTGGAGGAGTCTGGAGTCTGAATGGTGCAGAGAGCATGCAAGAGACTATGCAGGCCACCATCCAT
GTCCCTGCTCAGCACGAAGATGGCCCTGAGGATGACCCACAGCTTGTGGGCATCACTGCCCGGAATATTCCTCGAGAAGCCCAACTGGCTGCTGAGAACC
TGGGCATCAGCCTGGCCACCTTGCTGCTGAACAAAGGTGCCAAGAACATCCTGGATGTTGCACGGCAACTCAATGATGCCCACTAA


>BGISUSP0000900352
-----------EENSPKMRVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEI-AMSTTGDKILDTALSKIGEKSLFTKELEHALERN-VDLVVHSLKDL
PTVLPPGFTIGAVC-RECPYDAVVFHPKFVGKTLETLPEK-VVGTSSLRRAAQLQRKFPHLEFKS-RGNLNTRLRKLDELQEFSAIILAAAGLQRMGWQN
RVGQ-------------GALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLNGAESMQETMQATIH
VPAQHEDGPEDDPQLVGITARNIPREAQLAAENLGISLATLLLNKGAKNILDVARQLNDAH*