Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000149403 (click for geneview)
Transcript ID ENST00000278723(link to ensembl)
Symbol GRIK4
Localtion Chromosome:11:120036238:120362179:1 band: 11q23.3
Description Glutamate receptor, ionotropic kainate 4 precursor (Glutamate receptor KA-1) (KA1) (Excitatory amino acid receptor 1) (EAA1). [Source:Uniprot/SWISSPROT;Acc:Q16099]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------------------><-----------------
-M--P--R--V--S--A--P--L--V--L--L--P--A--W--L--V--M--V--A--C--S--P--H--S--L--R--I--A--A--I--L--D--D--
ATGCCCCGCGTCTCGGCGCCTTTGGTGCTGCTTCCTGCGTGGCTCGTGATGGTCGCCTGCAGCCCGCACTCCTTGAGGATCGCTGCTATCTTGGACGACC
                                                                                    :::::::::::.::::
------------------------------------------------------------------------------------GCTATCTTGGATGACC
-------------------------------------------------------------------------------------A--I--L--D--D--

----------------------------------------------------------------------------------------------------
P--M--E--C--S--R--G--E--R--L--S--I--T--L--A--K--N--R--I--N--R--A--P--E--R--L--G--K--A--K--V--E--V--D
CCATGGAGTGCAGCAGAGGGGAGCGGCTCTCCATCACCCTGGCCAAGAACCGCATCAACCGCGCTCCTGAGAGGCTGGGCAAGGCCAAGGTCGAAGTGGA
:::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCATGGAGTGCAGCAGAGGGGAGCGGCTCTCCATCACCNTGGCCAAGAACCGCATCAACCGCGCTCCTGAGAGGCTGGGCAAGGCCAAGGTCGAAGTGGA
P--M--E--C--S--R--G--E--R--L--S--I--T--X--A--K--N--R--I--N--R--A--P--E--R--L--G--K--A--K--V--E--V--D

----------------------------------------------><----------------------------------------------------
--I--F--E--L--L--R--D--S--E--Y--E--T--A--E--T--M--C--Q--I--L--P--K--G--V--V--A--V--L--G--P--S--S--S-
CATCTTTGAGCTTCTCAGAGACAGCGAGTACGAGACTGCAGAAACCATGTGTCAGATCCTCCCCAAGGGGGTGGTCGCTGTCCTCGGACCATCGTCCAGC
::::::::::::::::::::::::::::::::::::::::::::::                                                      
CATCTTTGAGCTTCTCAGAGACAGCGAGTACGAGACTGCAGAAACC------------------------------------------------------
--I--F--E--L--L--R--D--S--E--Y--E--T--A--E--T-------------------------------------------------------

--------------------------------------------><------------------------------------------------------
-P--A--S--S--S--I--I--S--N--I--C--G--E--K--E--V--P--H--F--K--V--A--P--E--E--F--V--K--F--Q--F--Q--R--
CCAGCCTCCAGCTCCATCATCAGCAACATCTGTGGAGAGAAGGAGGTCCCTCACTTCAAAGTGGCCCCAGAGGAGTTCGTCAAGTTCCAGTTCCAGAGAT
                                             ::::::::.:::::::::::::::::::::::..:::::::::::::::::::::
---------------------------------------------GTCCCTCATTTCAAAGTGGCCCCAGAGGAGTTTATCAAGTTCCAGTTCCAGAGAT
----------------------------------------------V--P--H--F--K--V--A--P--E--E--F--I--K--F--Q--F--Q--R--

----------------------------------------------------------------------------------------------------
F--T--T--L--N--L--H--P--S--N--T--D--I--S--V--A--V--A--G--I--L--N--F--F--N--C--T--T--A--C--L--I--C--A
TCACAACCCTGAACCTCCACCCCAGCAACACTGACATCAGCGTGGCTGTAGCTGGGATCCTGAACTTCTTCAACTGCACCACCGCCTGCCTCATCTGTGC
:::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TCACAACCCTGAACCTCCACCCCAGCAACACCGACATCAGCGTGGCTGTAGCTGGGATCCTGAACTTCTTCAACTGCACCACCGCCTGCCTCATCTGTGC
F--T--T--L--N--L--H--P--S--N--T--D--I--S--V--A--V--A--G--I--L--N--F--F--N--C--T--T--A--C--L--I--C--A

----------><----------------------------------------------------------------------------------------
--K--A--E--C--L--L--N--L--E--K--L--L--R--Q--F--L--I--S--K--D--T--L--S--V--R--M--L--D--D--T--R--D--P-
CAAAGCAGAATGCCTTTTAAACCTAGAGAAGCTGCTCCGGCAATTCCTTATCTCCAAGGACACGCTGTCCGTCCGCATGCTGGATGACACCCGGGACCCC
::::::::::                                                                                          
CAAAGCAGAA------------------------------------------------------------------------------------------
--K--A--E-------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------------><---------
-T--P--L--L--K--E--I--R--D--D--K--T--A--T--I--I--I--H--A--N--A--S--M--S--H--T--I--L--L--K--A--A--E--
ACCCCGCTCCTCAAGGAGATCCGGGACGACAAGACCGCCACCATCATCATCCACGCCAACGCCTCCATGTCCCACACCATCCTCCTGAAGGCAGCCGAAC
            ::::::::::::::::::::::: :::::::::::::::::::: ::.::::::::::::::::::::::::::::::          
------------AAGGAGATCCGGGACGACAAGACAGCCACCATCATCATCCACGCGAATGCCTCCATGTCCCACACCATCCTCCTGAAG----------
-------------K--E--I--R--D--D--K--T--A--T--I--I--I--H--A--N--A--S--M--S--H--T--I--L--L--K-----------

-------------------------------------------><-------------------------------------------------------
L--G--M--V--S--A--Y--Y--T--Y--I--F--T--N--L--E--F--S--L--Q--R--M--D--S--L--V--D--D--R--V--N--I--L--G
TTGGGATGGTGTCAGCCTATTACACATACATCTTCACTAATCTGGAGTTCTCACTCCAGAGAATGGACAGCCTTGTGGATGATCGTGTCAACATCCTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--S--I--F--N--Q--S--H--A--F--F--Q--E--F--A--Q--S--L--N--Q--S--W--Q--E--N--C--D--H--V--P--F--T--G-
ATTTTCCATTTTCAACCAATCCCATGCTTTCTTCCAAGAGTTTGCCCAGAGCCTCAACCAGTCCTGGCAGGAGAACTGTGACCATGTGCCCTTCACTGGG
                      ::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::.::::::::::: :: 
----------------------CACGCTTTCTTCCAAGAGTTTGCCCAGAGCCTCAACCAGTCCTGGCAGGAGAACTGTGAGCACGTGCCCTTCACAGGC
-----------------------H--A--F--F--Q--E--F--A--Q--S--L--N--Q--S--W--Q--E--N--C--E--H--V--P--F--T--G-

-----><---------------------------------------------------------------------------------------------
-P--A--L--S--S--A--L--L--F--D--A--V--Y--A--V--V--T--A--V--Q--E--L--N--R--S--Q--E--I--G--V--K--P--L--
CCTGCGCTCTCCTCGGCCCTGCTGTTTGATGCTGTCTATGCTGTGGTGACTGCGGTGCAGGAACTGAACCGGAGCCAAGAGATCGGCGTGAAGCCCTTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------><----------------------------------------
S--C--G--S--A--Q--I--W--Q--H--G--T--S--L--M--N--Y--L--R--M--V--E--L--E--G--L--T--G--H--I--E--F--N--S
CCTGCGGCTCGGCCCAGATCTGGCAGCACGGCACCAGCCTCATGAACTACCTGCGCATGGTAGAATTGGAAGGTCTTACCGGCCACATTGAATTCAACAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------><-----------------------------------
--K--G--Q--R--S--N--Y--A--L--K--I--L--Q--F--T--R--N--G--F--R--Q--I--G--Q--W--H--V--A--E--G--L--S--M-
CAAAGGCCAGAGGTCCAACTACGCTTTGAAAATCTTACAGTTCACAAGGAATGGTTTTCGGCAGATCGGCCAGTGGCACGTGGCAGAGGGCCTCAGCATG
                                                                ::.:::::::::::::::::::: ::::: ::::::
----------------------------------------------------------------ATTGGCCAGTGGCACGTGGCAGACGGCCTGAGCATG
-----------------------------------------------------------------I--G--Q--W--H--V--A--D--G--L--S--M-

-----------------------------------------------------------------------><---------------------------
-D--S--H--L--Y--A--S--N--I--S--D--T--L--F--N--T--T--L--V--V--T--T--I--L--E--N--P--Y--L--M--L--K--G--
GACAGCCACCTCTATGCCTCCAACATCTCGGACACTCTCTTCAACACCACCCTGGTCGTCACCACCATCCTGGAGAACCCATATTTAATGCTGAAGGGGA
:::::::.::::::.:::::::::::::: :::: :::::::::::::::::::::::::::::::::::::::.:::::.:::::::::::::::::::
GACAGCCGCCTCTACGCCTCCAACATCTCCGACAGTCTCTTCAACACCACCCTGGTCGTCACCACCATCCTGGAAAACCCGTATTTAATGCTGAAGGGGA
-D--S--R--L--Y--A--S--N--I--S--D--S--L--F--N--T--T--L--V--V--T--T--I--L--E--N--P--Y--L--M--L--K--G--

----------------------------------------------------------------------------------------------------
N--H--Q--E--M--E--G--N--D--R--Y--E--G--F--C--V--D--M--L--K--E--L--A--E--I--L--R--F--N--Y--K--I--R--L
ACCACCAGGAGATGGAAGGCAATGACCGCTACGAGGGCTTCTGTGTGGACATGCTCAAGGAGCTGGCAGAGATCCTCCGATTCAACTACAAGATCCGCCT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::
ACCACCAGGAGATGGAAGGCAATGACCGCTACGAGGGCTTCTGTGTGGACATGCTCAAGGAGCTGGCAGAGATCCTCCGGTTCAACTACAAGATCCGCCT
N--H--Q--E--M--E--G--N--D--R--Y--E--G--F--C--V--D--M--L--K--E--L--A--E--I--L--R--F--N--Y--K--I--R--L

---------------------------------------------------------------------------><-----------------------
--V--G--D--G--V--Y--G--V--P--E--A--N--G--T--W--T--G--M--V--G--E--L--I--A--R--K--A--D--L--A--V--A--G-
GGTTGGGGATGGCGTGTACGGCGTTCCCGAGGCCAACGGCACCTGGACGGGAATGGTCGGGGAGCTGATCGCTAGGAAAGCAGATCTGGCTGTGGCAGGC
:::.:::::.:::::::::::::: ::.::::::::.:::::::: ::.:::::::::::::::::::::::: ::::::::::::::::.:::::::::
GGTCGGGGACGGCGTGTACGGCGTGCCTGAGGCCAATGGCACCTGTACAGGAATGGTCGGGGAGCTGATCGCTCGGAAAGCAGATCTGGCCGTGGCAGGC
--V--G--D--G--V--Y--G--V--P--E--A--N--G--T--C--T--G--M--V--G--E--L--I--A--R--K--A--D--L--A--V--A--G-

-----------------------------------------------------------------------------------------><---------
-L--T--I--T--A--E--R--E--K--V--I--D--F--S--K--P--F--M--T--L--G--I--S--I--L--Y--R--V--H--M--G--R--K--
CTCACCATTACAGCTGAACGGGAGAAGGTGATTGATTTCTCTAAGCCATTCATGACTCTGGGAATTAGCATTCTTTACCGCGTTCATATGGGACGCAAAC
::::::::.::.::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::: :::::::::          
CTCACCATCACGGCTGAACGGGAGAAGGTGATTGATTTCTCAAAGCCATTCATGACTCTGGGAATTAGCATTCTTTACCGAGTTCATATG----------
-L--T--I--T--A--E--R--E--K--V--I--D--F--S--K--P--F--M--T--L--G--I--S--I--L--Y--R--V--H--M-----------

--------------------------------------------------------------------------------------------------->
P--G--Y--F--S--F--L--D--P--F--S--P--G--V--W--L--F--M--L--L--A--Y--L--A--V--S--C--V--L--F--L--V--A--R
CCGGCTATTTCTCCTTCCTGGACCCATTTTCTCCGGGCGTCTGGCTCTTCATGCTTCTAGCCTATCTGGCCGTCAGCTGTGTCCTCTTCCTGGTGGCTCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

<---------------------------------------------------------------------------------------------------
--L--T--P--Y--E--W--Y--S--P--H--P--C--A--Q--G--R--C--N--L--L--V--N--Q--Y--S--L--G--N--S--L--W--F--P-
GTTGACGCCCTACGAGTGGTACAGCCCACACCCATGTGCCCAGGGCCGGTGCAACCTCCTGGTGAACCAGTACTCCCTGGGCAACAGCCTCTGGTTTCCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------><-------------------------
-V--G--G--F--M--Q--Q--G--S--T--I--A--P--R--A--L--S--T--R--C--V--S--G--V--W--W--A--F--T--L--I--I--I--
GTCGGGGGGTTCATGCAGCAAGGCTCCACCATCGCCCCTCGCGCCTTATCCACCCGCTGTGTCAGTGGCGTCTGGTGGGCATTCACGCTGATCATCATCT
                                                                                       :::::::::::::
---------------------------------------------------------------------------------------CTGATCATCATCT
----------------------------------------------------------------------------------------L--I--I--I--

----------------------------------------------------------------------------------------------------
S--S--Y--T--A--N--L--A--A--F--L--T--V--Q--R--M--D--V--P--I--E--S--V--D--D--L--A--D--Q--T--A--I--E--Y
CATCCTACACGGCCAACCTGGCAGCCTTCCTGACCGTGCAGCGCATGGATGTGCCCATTGAGTCAGTGGATGACCTGGCTGACCAGACCGCCATTGAATA
::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::
CATCCTACACGGCCAACCTGGCAGC-TTCCTGACCGTGCAGCGCATGGATGTGCCCATTGAGTCAGTGGACGACCTGGCTGACCAGACCGCCATTGAATA
S--S--Y--T--A--N--L--A--A--F--L--T--V--Q--R--M--D--V--P--I--E--S--V--D--D--L--A--D--Q--T--A--I--E--Y

------------------------------------------><--------------------------------------------------------
--G--T--I--H--G--G--S--S--M--T--F--F--Q--N--S--R--Y--Q--T--Y--Q--R--M--W--N--Y--M--Y--S--K--Q--P--S-
TGGCACAATTCACGGAGGCTCCAGCATGACCTTCTTCCAAAATTCCCGCTACCAGACCTACCAACGCATGTGGAATTACATGTATTCCAAGCAGCCCAGC
:::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.::::::::::::::::::::.::::::::::::::.
TGGCACAATTCACGGAGGCTCCAGCATGACCTTCTTCCAAAATTCCCGCTATCAGACCTACCAGCGCATGTGGAATTACATGTACTCCAAGCAGCCCAGT
--G--T--I--H--G--G--S--S--M--T--F--F--Q--N--S--R--Y--Q--T--Y--Q--R--M--W--N--Y--M--Y--S--K--Q--P--S-

----------------------------------------------------------------------------------------------------
-V--F--V--K--S--T--E--E--G--I--A--R--V--L--N--S--N--Y--A--F--L--L--E--S--T--M--N--E--Y--Y--R--Q--R--
GTGTTCGTGAAGAGCACAGAGGAGGGAATCGCCAGGGTGTTGAATTCCAACTACGCCTTCCTCCTGGAATCCACCATGAACGAGTACTATCGGCAGCGAA
:::::.::::::::::: ::::::::.:::::::::::::::::.::::::::::::::::: :::::.:::::::::::::::::::::::::::::::
GTGTTTGTGAAGAGCACCGAGGAGGGGATCGCCAGGGTGTTGAACTCCAACTACGCCTTCCTGCTGGAGTCCACCATGAACGAGTACTATCGGCAGCGAA
-V--F--V--K--S--T--E--E--G--I--A--R--V--L--N--S--N--Y--A--F--L--L--E--S--T--M--N--E--Y--Y--R--Q--R--

--------------------------------------------------------------------><------------------------------
N--C--N--L--T--Q--I--G--G--L--L--D--T--K--G--Y--G--I--G--M--P--V--G--S--V--F--R--D--E--F--D--L--A--I
ACTGCAACCTCACTCAGATTGGGGGCCTGCTGGACACCAAGGGCTATGGGATTGGCATGCCAGTCGGCTCGGTTTTCCGGGACGAGTTTGATCTGGCCAT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::                                   
ACTGCAACCTCACTCAGATTGGGGGCCTGCTGGACACCAAGGGCTATGGGATTGGCATGCCAGTC-----------------------------------
N--C--N--L--T--Q--I--G--G--L--L--D--T--K--G--Y--G--I--G--M--P--V------------------------------------

-------------------------------------------------------------------------------------------------><-
--L--Q--L--Q--E--N--N--R--L--E--I--L--K--R--K--W--W--E--G--G--K--C--P--K--E--E--D--H--R--A--K--G--L-
TCTCCAGCTGCAGGAGAACAACCGCCTGGAGATCCTGAAGCGCAAATGGTGGGAAGGAGGGAAGTGCCCCAAGGAGGAAGATCACAGAGCTAAAGGCCTG
                                                                                                 :::
-------------------------------------------------------------------------------------------------CTG
--------------------------------------------------------------------------------------------------L-

----------------------------------------------------------------------------------------------------
-G--M--E--N--I--G--G--I--F--V--V--L--I--C--G--L--I--V--A--I--F--M--A--M--L--E--F--L--W--T--L--R--H--
GGAATGGAGAATATTGGTGGAATCTTTGTGGTTCTTATTTGTGGCTTAATCGTGGCCATTTTTATGGCTATGTTGGAGTTTTTATGGACTCTCAGACACT
:: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.::: :.::.:
GGCATGGAGAATATTGGTGGAATCTTTGTGGTTCTTATTTGTGGCTTAATCGTGGCCATTTTTATGGCTATGTTGGAGTTTTTGTGGACCCTCCGGCATT
-G--M--E--N--I--G--G--I--F--V--V--L--I--C--G--L--I--V--A--I--F--M--A--M--L--E--F--L--W--T--L--R--H--

----------------><----------------------------------------------------------------------------------
S--E--A--T--E--V--S--V--C--Q--E--M--V--T--E--L--R--S--I--I--L--C--Q--D--S--I--H--P--R--R--R--R--A--A
CAGAAGCAACTGAGGTGTCCGTCTGCCAGGAGATGGTGACCGAGCTGCGCAGCATTATCCTGTGTCAGGACAGTATCCACCCCCGCCGGCGGCGCGCCGC
: :::::.:::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::.::::::: :::::::::::: ::: 
CTGAAGCGACTGAGGTGTCCGTCTGCCAGGAGATGGTGACCGAGCTGCGCAGCATCATCCTGTGTCAGGACAGTGTCCACCCGCGCCGGCGGCGCTCCGG
S--E--A--T--E--V--S--V--C--Q--E--M--V--T--E--L--R--S--I--I--L--C--Q--D--S--V--H--P--R--R--R--R--S--G

----------------------------------------------------------------------------------------------------
--V--P--P--P--R--P--P--I--P--E--E--R--R--P--R--G--T--A--T--L--S--N--G--K--L--C--G--A--G--E--P--D--Q-
AGTCCCGCCGCCCCGGCCCCCCATCCCCGAGGAGCGCCGACCGCGGGGCACGGCGACGCTCAGCAACGGGAAGCTGTGCGGGGCAGGGGAGCCCGACCAG
  : :: :::::::::::::::::::: ::::::::.::.:: :::::::: :.::::::::::::::: :::::::::::::: :::::::::::::::
CCTGCCTCCGCCCCGGCCCCCCATCCCGGAGGAGCGTCGGCCCCGGGGCACCGTGACGCTCAGCAACGGCAAGCTGTGCGGGGCCGGGGAGCCCGACCAG
--L--P--P--P--R--P--P--I--P--E--E--R--R--P--R--G--T--V--T--L--S--N--G--K--L--C--G--A--G--E--P--D--Q-

----------------------------------------------------------------------------------------------------
-L--A--Q--R--L--A--Q--E--A--A--L--V--A--R--G--C--T--H--I--R--V--C--P--E--C--R--R--F--Q--G--L--R--A--
CTCGCGCAGAGACTGGCGCAGGAGGCCGCCCTGGTGGCCCGCGGCTGCACGCACATCCGCGTCTGCCCCGAGTGCCGCCGCTTCCAGGGCCTGCGGGCAC
:: :::::::::::::: ::.::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::.::::::::::::::::: :
CTGGCGCAGAGACTGGCCCAAGAGGCCGCCCTGGTGGCCCGCGGCTGCACGCACATCCGCGTGTGCCCCGAGTGCCGCCGTTTCCAGGGCCTGCGGGCTC
-L--A--Q--R--L--A--Q--E--A--A--L--V--A--R--G--C--T--H--I--R--V--C--P--E--C--R--R--F--Q--G--L--R--A--

-----------------------------------------------------------------------
R--P--S--P--A--R--S--E--E--S--L--E--W--E--K--T--T--N--S--S--E--P--E--*-
GGCCGTCGCCCGCCCGCAGCGAGGAGAGCCTGGAGTGGGAGAAAACCACCAACAGCAGCGAGCCCGAGTAG
::::::::::::: :::                                                      
GGCCGTCGCCCGCGCGC------------------------------------------------------
R--P--S--P--A--R-------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000883203
------------------------------------------------------------------------------------GCTATCTTGGATGACC
CCATGGAGTGCAGCAGAGGGGAGCGGCTCTCCATCACCNTGGCCAAGAACCGCATCAACCGCGCTCCTGAGAGGCTGGGCAAGGCCAAGGTCGAAGTGGA
CATCTTTGAGCTTCTCAGAGACAGCGAGTACGAGACTGCAGAAACC------------------------------------------------------
---------------------------------------------GTCCCTCATTTCAAAGTGGCCCCAGAGGAGTTTATCAAGTTCCAGTTCCAGAGAT
TCACAACCCTGAACCTCCACCCCAGCAACACCGACATCAGCGTGGCTGTAGCTGGGATCCTGAACTTCTTCAACTGCACCACCGCCTGCCTCATCTGTGC
CAAAGCAGAA------------------------------------------------------------------------------------------
------------AAGGAGATCCGGGACGACAAGACAGCCACCATCATCATCCACGCGAATGCCTCCATGTCCCACACCATCCTCCTGAAG----------
----------------------------------------------------------------------------------------------------
----------------------CACGCTTTCTTCCAAGAGTTTGCCCAGAGCCTCAACCAGTCCTGGCAGGAGAACTGTGAGCACGTGCCCTTCACAGGC
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------ATTGGCCAGTGGCACGTGGCAGACGGCCTGAGCATG
GACAGCCGCCTCTACGCCTCCAACATCTCCGACAGTCTCTTCAACACCACCCTGGTCGTCACCACCATCCTGGAAAACCCGTATTTAATGCTGAAGGGGA
ACCACCAGGAGATGGAAGGCAATGACCGCTACGAGGGCTTCTGTGTGGACATGCTCAAGGAGCTGGCAGAGATCCTCCGGTTCAACTACAAGATCCGCCT
GGTCGGGGACGGCGTGTACGGCGTGCCTGAGGCCAATGGCACCTGTACAGGAATGGTCGGGGAGCTGATCGCTCGGAAAGCAGATCTGGCCGTGGCAGGC
CTCACCATCACGGCTGAACGGGAGAAGGTGATTGATTTCTCAAAGCCATTCATGACTCTGGGAATTAGCATTCTTTACCGAGTTCATATG----------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------CTGATCATCATCT
CATCCTACACGGCCAACCTGGCatTCCTGACCGTGCAGCGCATGGATGTGCCCATTGAGTCAGTGGACGACCTGGCTGACCAGACCGCCATTGAATATGG
CACAATTCACGGAGGCTCCAGCATGACCTTCTTCCAAAATTCCCGCTATCAGACCTACCAGCGCATGTGGAATTACATGTACTCCAAGCAGCCCAGTGTG
TTTGTGAAGAGCACCGAGGAGGGGATCGCCAGGGTGTTGAACTCCAACTACGCCTTCCTGCTGGAGTCCACCATGAACGAGTACTATCGGCAGCGAAACT
GCAACCTCACTCAGATTGGGGGCCTGCTGGACACCAAGGGCTATGGGATTGGCATGCCAGTC--------------------------------------
----------------------------------------------------------------------------------------------CTGGGC
ATGGAGAATATTGGTGGAATCTTTGTGGTTCTTATTTGTGGCTTAATCGTGGCCATTTTTATGGCTATGTTGGAGTTTTTGTGGACCCTCCGGCATTCTG
AAGCGACTGAGGTGTCCGTCTGCCAGGAGATGGTGACCGAGCTGCGCAGCATCATCCTGTGTCAGGACAGTGTCCACCCGCGCCGGCGGCGCTCCGGCCT
GCCTCCGCCCCGGCCCCCCATCCCGGAGGAGCGTCGGCCCCGGGGCACCGTGACGCTCAGCAACGGCAAGCTGTGCGGGGCCGGGGAGCCCGACCAGCTG
GCGCAGAGACTGGCCCAAGAGGCCGCCCTGGTGGCCCGCGGCTGCACGCACATCCGCGTGTGCCCCGAGTGCCGCCGTTTCCAGGGCCTGCGGGCTCGGC
CGTCGCCCGCGCGC------------------------------------------------------


>BGISUSP0000883203
----------------------------AILDDPMECSRGERLSIT-AKNRINRAPERLGKAKVEVDIFELLRDSEYETAET------------------
---------------VPHFKVAPEEFIKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAE------------------------------
----KEIRDDKTATIIIHANASMSHTILLK--------------------------------------------HAFFQEFAQSLNQSWQENCEHVPFTG
----------------------------------------------------------------------------------------IGQWHVADGLSM
DSRLYASNISDSLFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTCTGMVGELIARKADLAVAG
LTITAEREKVIDFSKPFMTLGISILYRVHM----------------------------------------------------------------------
-----------------------------LIIISSYTANLAFLTVQRMDVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSV
FVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPV--------------------------------------------LG
MENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVSVCQEMVTELRSIILCQDSVHPRRRRSGLPPPRPPIPEERRPRGTVTLSNGKLCGAGEPDQL
AQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPAR------------------