Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000110274 (click for geneview)
Transcript ID ENST00000278935(link to ensembl)
Symbol NP_055771.3
Localtion Chromosome:11:116714482:116789190:1 band: 11q23.3
Description KIAA1052 protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------------------><--------------
-V--M--A--G--R--P--L--R--I--G--D--Q--L--V--L--E--E--D--Y--D--E--T--Y--I--P--S--E--Q--E--I--L--E--F--
GTCATGGCTGGACGACCCCTCCGCATAGGAGATCAGCTGGTTCTGGAAGAAGATTATGATGAGACCTACATTCCTAGTGAGCAAGAAATTCTTGAATTTG
:::::::::::: ::::: :.:::::::::::.::::::::: ::::.:::::::::::::::::::::::.::.:::::::::                
GTCATGGCTGGAAGACCCATTCGCATAGGAGACCAGCTGGTTNTGGAGGAAGATTATGATGAGACCTACATCCCCAGTGAGCAA----------------
-V--M--A--G--R--P--I--R--I--G--D--Q--L--V--X--E--E--D--Y--D--E--T--Y--I--P--S--E--Q-----------------

------------------------------------------------------------------------------------------------><--
A--R--E--I--G--I--D--P--I--K--E--P--E--L--M--W--L--A--R--E--G--I--V--A--P--L--P--G--E--W--K--P--C--Q
CCCGGGAGATTGGTATTGATCCCATCAAGGAACCAGAACTGATGTGGCTGGCGCGAGAGGGCATCGTGGCCCCACTGCCTGGAGAGTGGAAACCATGCCA
                                                     ::.::::::::.::::::::::::::::.:::::::::::::   ::
-----------------------------------------------------CGGGAGGGCATTGTGGCCCCACTGCCTGAAGAGTGGAAACCA---CA
------------------------------------------------------R--E--G--I--V--A--P--L--P--E--E--W--K--P-----Q

----------------------------------------------------------------------------------------------------
--D--I--T--G--D--I--Y--Y--F--N--F--A--N--G--Q--S--M--W--D--H--P--C--D--E--H--Y--R--S--L--V--I--Q--E-
GGACATCACAGGTGACATTTACTATTTCAACTTCGCCAACGGGCAGTCTATGTGGGACCATCCATGTGACGAACACTATCGGAGCTTGGTGATCCAAGAG
:::::::::::::::.::::::::::::. :::.::.::.::::::::.:::::::::::::: :::::.::.::::::::::.:::::...:::::: :
GGACATCACAGGTGATATTTACTATTTCGCCTTTGCTAATGGGCAGTCCATGTGGGACCATCCCTGTGATGAGCACTATCGGAACTTGGCAGTCCAAGCG
--D--I--T--G--D--I--Y--Y--F--A--F--A--N--G--Q--S--M--W--D--H--P--C--D--E--H--Y--R--N--L--A--V--Q--A-

-----------------------------------------------------------------------------------------------><---
-R--A--K--L--S--T--S--G--A--I--K--K--K--K--K--K--K--E--K--K--D--K--K--D--R--D--P--P--K--S--S--L--A--
CGGGCAAAGCTGTCAACTTCTGGGGCCATTAAGAAGAAGAAAAAAAAAAAGGAAAAGAAAGACAAGAAGGACAGAGACCCCCCCAAAAGTTCGCTGGCCT
. :: .:::::::::.::.:::::::::::::::::::..::::.::::::.. ::::..                                        
TTGGGGAAGCTGTCAGCTCCTGGGGCCATTAAGAAGAAAGAAAAGAAAAAGAGCAAGAGG----------------------------------------
-L--G--K--L--S--A--P--G--A--I--K--K--K--E--K--K--K--S--K--R-----------------------------------------

----------------------------------------------------------------------------------------------------
L--G--S--S--L--A--P--V--H--V--P--L--G--G--L--A--P--L--R--G--L--V--D--T--P--P--S--A--L--R--G--S--Q--S
TGGGTTCCTCATTAGCCCCAGTTCATGTTCCTCTTGGGGGCCTGGCTCCTTTACGAGGTCTTGTGGATACCCCACCCTCTGCTCTTCGTGGATCTCAAAG
                                                                                   :: ::::::::::::::
-----------------------------------------------------------------------------------CTGCGTGGATCTCAAAG
------------------------------------------------------------------------------------L--R--G--S--Q--S

------------------------------------------------------><--------------------------------------------
--V--S--L--G--S--S--V--E--S--G--R--Q--L--G--E--L--M--L--P--S--Q--G--L--K--T--S--A--Y--T--K--G--L--L-
CGTGAGCCTGGGGAGCTCAGTGGAGTCTGGACGTCAGCTTGGAGAACTCATGCTGCCTTCACAGGGTCTCAAGACCTCTGCTTATACAAAGGGTCTCTTG
.:::::::::::::.:::.::::::::..:    :::::::::::::::      :: ::: :::.:::::::::.:::.::::::::::::::::::::
TGTGAGCCTGGGGAACTCGGTGGAGTCCAGT---CAGCTTGGAGAACTC------CCATCAGAGGATCTCAAGACTTCTACTTATACAAAGGGTCTCTTG
--V--S--L--G--N--S--V--E--S--S-----Q--L--G--E--L--------P--S--E--D--L--K--T--S--T--Y--T--K--G--L--L-

-----------------------------------------------------------------------------------------><---------
-G--S--I--Y--E--D--K--T--A--L--S--L--L--G--L--G--E--E--T--N--E--E--D--E--E--E--S--D--N--Q--S--V--H--
GGCTCCATATATGAGGACAAGACTGCTCTCAGCCTCTTGGGTTTAGGAGAAGAAACCAATGAGGAGGATGAGGAGGAAAGTGACAACCAGAGTGTCCACA
:::::: : .:::.:::::::: ::::::::::::::::: ::::::.::.::.::. ::::::::::::::: .::.::::::::.   ::::::..::
GGCTCCTTCCATGGGGACAAGAATGCTCTCAGCCTCTTGGCTTTAGGGGAGGAGACTTATGAGGAGGATGAGGCAGAGAGTGACAAT---AGTGTCTGCA
-G--S--F--H--G--D--K--N--A--L--S--L--L--A--L--G--E--E--T--Y--E--E--D--E--A--E--S--D--N-----S--V--C--

-------------------------------------------------------------------><-------------------------------
S--S--S--E--P--L--R--N--L--H--L--D--I--G--A--L--G--G--D--F--E--Y--E--E--S--L--R--T--S--Q--P--E--E--K
GCTCAAGTGAGCCTCTTAGGAACCTACACCTGGACATTGGGGCACTGGGGGGTGACTTTGAGTATGAGGAGTCTCTGAGAACAAGCCAGCCAGAGGAGAA
::::::::::::.:::::.::::::.:::::::::::..::::::::::::::::::::::::.::::::.::::..:::::::::::::::::::::::
GCTCAAGTGAGCTTCTTAAGAACCTGCACCTGGACATCAGGGCACTGGGGGGTGACTTTGAGTGTGAGGAATCTCCAAGAACAAGCCAGCCAGAGGAGAA
S--S--S--E--L--L--K--N--L--H--L--D--I--R--A--L--G--G--D--F--E--C--E--E--S--P--R--T--S--Q--P--E--E--K

----------------------------------------------------------------------------------------------------
--K--D--V--S--L--D--S--D--A--A--G--P--P--T--P--C--K--P--S--S--P--G--A--D--S--S--L--S--S--A--V--G--K-
GAAGGATGTTTCTCTGGATTCAGATGCTGCCGGTCCCCCTACTCCCTGCAAGCCCTCCAGCCCAGGTGCAGACAGCAGTCTGAGCAGTGCTGTTGGCAAA
.:::::.:::::::: :::::::::::::::::.::::: :::::. .:::: .::..:::: ::::::::::..:::.:::::::::::.: :::::::
AAAGGACGTTTCTCTTGATTCAGATGCTGCCGGCCCCCCGACTCCTGACAAGGTCTTTAGCCAAGGTGCAGACGACAGCCTGAGCAGTGCCGATGGCAAA
--K--D--V--S--L--D--S--D--A--A--G--P--P--T--P--D--K--V--F--S--Q--G--A--D--D--S--L--S--S--A--D--G--K-

----------------------------------------------------------------------------------------------------
-G--R--Q--G--S--G--A--R--P--G--L--P--E--K--E--E--N--E--K--S--E--P--K--I--C--R--N--L--V--T--P--K--A--
GGGCGACAGGGAAGTGGAGCAAGACCTGGTCTTCCAGAAAAAGAGGAAAATGAGAAGAGTGAACCTAAGATTTGCAGGAATCTGGTGACCCCCAAGGCAG
:::::::  ::::: ::.:::                                                                               
GGGCGACCTGGAAGAGGGGCA-------------------------------------------------------------------------------
-G--R--P--G--R--G--A--------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--P--T--G--S--E--P--A--K--A--S--E--K--E--A--P--E--D--T--V--D--A--G--E--E--G--S--R--R--E--E--A--A--K
ACCCTACAGGCAGTGAGCCTGCCAAAGCCTCTGAAAAGGAAGCACCAGAGGACACAGTAGATGCAGGAGAGGAGGGTTCCAGGAGGGAAGAGGCAGCCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------><--------------------------------------------
--E--P--K--K--K--A--S--A--L--E--E--G--S--S--D--A--S--Q--E--L--E--I--S--E--H--M--K--E--P--Q--L--S--D-
GGAGCCAAAGAAGAAGGCTTCTGCTCTGGAAGAGGGCAGTTCAGACGCCAGCCAAGAACTGGAAATTAGTGAACACATGAAGGAACCACAGCTCTCAGAC
                                                       ::...:::.:::::::::::.::::::::::.. :::::::::::
-------------------------------------------------------GAGTCGGAGATTAGTGAACATATGAAGGAACTGAAGCTCTCAGAC
--------------------------------------------------------E--S--E--I--S--E--H--M--K--E--L--K--L--S--D-

-----------------------------------><---------------------------------------------------------------
-S--I--A--S--D--P--K--S--F--H--G--L--D--F--G--F--R--S--R--I--S--E--H--L--L--D--V--D--V--L--S--P--V--
TCCATAGCTTCTGACCCCAAGTCCTTCCATGGCCTGGACTTCGGTTTTCGCAGCCGGATCTCGGAGCACCTGCTGGATGTTGATGTGCTTTCCCCAGTCC
::::. ::::::::::::::::::::::.:::::::                                                                
TCCACTGCTTCTGACCCCAAGTCCTTCCGTGGCCTG----------------------------------------------------------------
-S--T--A--S--D--P--K--S--F--R--G--L-----------------------------------------------------------------

-------------------><-------------------------------------------------------------------------------
L--G--G--A--C--R--Q--A--Q--Q--P--L--G--I--E--D--K--D--D--S--Q--S--S--Q--D--E--L--Q--S--K--Q--S--K--G
TGGGTGGAGCTTGTCGGCAGGCCCAGCAACCACTGGGAATAGAAGACAAGGATGACAGCCAGTCCAGCCAAGATGAGCTGCAGAGCAAGCAGTCCAAAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------><------------------------------------------------------------------------------
--L--E--E--R--Y--H--R--L--S--P--P--L--P--H--E--E--R--A--Q--S--P--P--R--S--L--A--T--E--E--E--P--P--Q-
CCTGGAGGAGAGGTACCATAGGTTATCTCCTCCACTTCCACACGAGGAGCGGGCCCAGAGTCCCCCTCGCAGCCTGGCCACTGAAGAAGAGCCTCCCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------><----------
-G--P--E--G--Q--P--E--W--K--E--A--E--E--L--G--E--D--S--A--A--S--L--S--L--Q--L--S--L--Q--R--E--Q--A--
GGCCCCGAGGGGCAGCCCGAGTGGAAGGAGGCAGAGGAGCTTGGGGAGGACTCTGCAGCCAGCCTCAGCCTGCAGCTGTCCCTCCAGAGGGAGCAGGCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--S--P--P--A--A--C--E--K--G--K--E--Q--H--S--Q--A--E--E--L--G--P--G--Q--E--E--A--E--D--P--E--E--K--V
CAAGCCCACCTGCTGCCTGTGAGAAGGGCAAGGAGCAGCATTCCCAGGCCGAGGAGCTGGGCCCTGGGCAGGAAGAGGCAGAGGATCCTGAGGAGAAGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------><---------------------------------------------------------------
--A--V--S--P--T--P--P--V--S--P--E--V--R--S--T--E--P--V--A--P--P--E--Q--L--S--E--A--A--L--K--A--M--E-
GGCGGTCAGCCCCACCCCGCCAGTCTCTCCAGAGGTGCGATCCACAGAGCCTGTGGCTCCCCCAGAGCAGCTCTCAGAGGCTGCACTAAAGGCCATGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--A--V--A--Q--V--L--E--Q--D--Q--R--H--L--L--E--S--K--Q--E--K--M--Q--Q--L--R--E--K--L--C--Q--E--E--
GAGGCAGTGGCCCAAGTACTCGAGCAAGACCAGAGGCACCTGCTGGAATCCAAGCAAGAGAAGATGCAGCAACTGCGGGAGAAGCTGTGCCAAGAGGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------><-----------------------------------------------------
E--E--E--I--L--R--L--H--Q--Q--K--E--Q--S--L--S--S--L--R--E--R--L--Q--K--A--I--E--E--E--E--A--R--M--R
AAGAGGAGATCCTCCGGCTTCACCAGCAGAAAGAGCAATCTCTCAGTTCCTTGAGGGAGCGGCTGCAGAAAGCCATTGAGGAGGAGGAGGCCCGGATGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------><---------------------
--E--E--E--S--Q--R--L--S--W--L--R--A--Q--V--Q--S--S--T--Q--A--D--E--D--Q--I--R--A--E--Q--E--A--S--L-
AGAGGAGGAAAGCCAGAGGCTATCCTGGCTCCGAGCTCAGGTCCAGTCCAGCACACAAGCAGATGAGGACCAAATCAGGGCTGAGCAAGAGGCTTCCCTG
                                                                               ::.::::: ::::::::::::
-------------------------------------------------------------------------------GCCGAGCACGAGGCTTCCCTG
--------------------------------------------------------------------------------A--E--H--E--A--S--L-

----------------------------------------------------------------------------------------------------
-Q--K--L--R--E--E--L--E--S--Q--Q--K--A--E--R--A--S--L--E--Q--K--N--R--Q--M--L--E--Q--L--K--E--E--I--
CAGAAACTGAGAGAAGAGTTGGAGTCTCAACAGAAGGCTGAGAGGGCCAGCTTGGAACAGAAAAATAGGCAAATGCTGGAGCAGCTCAAGGAAGAGATAG
::::..:::::::::::::::::::::: ::::::.:: :::::::::::::::::. :::.:::.:::::.:.::::::: ::::::.:::.::: :.:
CAGAGGCTGAGAGAAGAGTTGGAGTCTCTACAGAAAGCAGAGAGGGCCAGCTTGGAGAAGAGAAACAGGCAGACGCTGGAGAAGCTCAGGGAGGAGCTGG
-Q--R--L--R--E--E--L--E--S--L--Q--K--A--E--R--A--S--L--E--K--R--N--R--Q--T--L--E--K--L--R--E--E--L--

----------------------------------------------------------------------------------------------><----
E--A--S--E--K--S--E--Q--A--A--L--N--A--A--K--E--K--A--L--Q--Q--L--R--E--Q--L--E--G--E--R--K--E--A--V
AGGCTTCGGAGAAGAGCGAGCAGGCTGCCCTGAATGCTGCAAAGGAGAAGGCTCTGCAGCAGCTGAGGGAGCAGCTGGAAGGGGAGAGGAAAGAAGCTGT
:::::::.:::::::: ::.:::::.::: ::::::: : .:::::: .:::..:::.:::::::::. ::::.:::::::::::::::::::::     
AGGCTTCAGAGAAGAGAGAACAGGCCGCCATGAATGCGGAGAAGGAGCGGGCCTTGCGGCAGCTGAGACAGCAACTGGAAGGGGAGAGGAAAGAA-----
E--A--S--E--K--R--E--Q--A--A--M--N--A--E--K--E--R--A--L--R--Q--L--R--Q--Q--L--E--G--E--R--K--E------

------------------------------------------------------------------------><--------------------------
--A--T--L--E--K--E--H--S--A--E--L--E--R--L--C--S--S--L--E--A--K--H--R--E--V--V--S--S--L--Q--K--K--I-
GGCAACGCTGGAGAAGGAGCACAGTGCTGAGCTGGAGCGGCTCTGCTCCTCATTGGAGGCCAAGCACCGGGAGGTGGTCTCCAGCCTCCAGAAGAAGATA
 ::..:::::::::.::::::::: :  :::::::::::::::: : ::::..:::::::::::::: :.:::::::::::::::::::::::::::::.
-GCGGCGCTGGAGAGGGAGCACAGGGAGGAGCTGGAGCGGCTCTCCGCCTCGCTGGAGGCCAAGCACGGAGAGGTGGTCTCCAGCCTCCAGAAGAAGATG
--A--A--L--E--R--E--H--R--E--E--L--E--R--L--S--A--S--L--E--A--K--H--G--E--V--V--S--S--L--Q--K--K--M-

----------------------------------------------------------------------------------------------------
-Q--E--A--Q--Q--K--E--E--A--Q--L--Q--K--C--L--G--Q--V--E--H--R--V--H--Q--K--S--Y--H--V--A--G--Y--E--
CAGGAAGCTCAACAGAAAGAGGAGGCCCAGCTGCAGAAGTGCCTTGGGCAAGTGGAGCACAGAGTTCACCAGAAGTCTTATCACGTGGCTGGGTATGAGC
 :.::::::::.:::::::::.::::::::::::::.:: ::.  :: :..:.:::::: ::::.:::.:.:::: ::.:.:: ::: .::.::::::::
GAAGAAGCTCAGCAGAAAGAGAAGGCCCAGCTGCAGGAGAGCTGGGGCCGGGCGGAGCAGAGAGCTCATCGGAAGGCTCACCAGGTGCTTGAGTATGAGC
-E--E--A--Q--Q--K--E--K--A--Q--L--Q--E--S--W--G--R--A--E--Q--R--A--H--R--K--A--H--Q--V--L--E--Y--E--

----><----------------------------------------------------------------------------------------------
H--E--L--S--S--L--L--R--E--K--R--Q--E--V--E--G--E--H--E--R--R--L--D--K--M--K--E--E--H--Q--Q--V--M--A
ACGAGCTCAGCAGTCTCCTGCGAGAGAAGCGCCAGGAAGTGGAAGGGGAGCATGAGAGGAGGTTGGACAAGATGAAGGAGGAGCACCAGCAAGTGATGGC
: :::                                                                                               
AAGAG-----------------------------------------------------------------------------------------------
Q--E------------------------------------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
--K--A--R--E--Q--Y--E--A--E--E--R--K--Q--R--A--E--L--L--G--H--L--T--G--E--L--E--R--L--Q--R--A--H--E-
TAAGGCCAGAGAGCAGTATGAAGCTGAGGAGAGGAAGCAGCGGGCTGAGCTTCTGGGGCACCTGACCGGAGAGCTGGAGCGCCTGCAGAGGGCCCATGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------><---------------------------
-R--E--L--E--T--V--R--Q--E--Q--H--K--R--L--E--D--L--R--R--R--H--R--E--Q--E--R--K--L--Q--D--L--E--L--
CGAGAACTGGAGACTGTGAGGCAGGAGCAACACAAGCGTCTTGAGGACTTGCGGCGCCGGCACAGGGAGCAGGAAAGGAAGCTCCAGGATTTAGAGTTGG
                                                                        ::::::::.:::::.::::::::: :::
------------------------------------------------------------------------GAAAGGAAACTCCAAGATTTAGAGGTGG
-------------------------------------------------------------------------E--R--K--L--Q--D--L--E--V--

-------------------------------------------------------><-------------------------------------------
D--L--E--T--R--A--K--D--V--K--A--R--L--A--L--L--E--V--Q--E--E--T--A--R--R--E--K--Q--Q--L--L--D--V--Q
ACCTTGAAACCAGAGCTAAAGATGTCAAGGCCAGATTGGCTCTGCTGGAGGTCCAGGAGGAGACCGCCCGGAGGGAGAAGCAGCAGCTGCTTGATGTGCA
: ::::::::::::.:.::.::.::::::::::::::::::: :::::: ::.::::::: . :::::::.:.::::::::::::::: ::..:::::::
AACTTGAAACCAGAACCAAGGACGTCAAGGCCAGATTGGCTCAGCTGGATGTTCAGGAGGCATCCGCCCGAAAGGAGAAGCAGCAGCTCCTCAATGTGCA
E--L--E--T--R--T--K--D--V--K--A--R--L--A--Q--L--D--V--Q--E--A--S--A--R--K--E--K--Q--Q--L--L--N--V--Q

------------------------><--------------------------------------------------------------------------
--R--Q--V--A--L--K--S--E--E--A--T--A--T--H--Q--Q--L--E--E--A--Q--K--E--H--T--H--L--L--Q--S--N--Q--Q-
GAGGCAGGTTGCTCTGAAGAGTGAGGAAGCCACAGCCACCCATCAGCAGCTGGAGGAGGCACAGAAGGAGCACACCCACCTGTTGCAGTCAAACCAGCAG
:::::::::::: :::.::::::::                                                                           
GAGGCAGGTTGCACTGGAGAGTGAG---------------------------------------------------------------------------
--R--Q--V--A--L--E--S--E----------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--R--E--I--L--D--E--L--Q--A--R--K--L--K--L--E--S--Q--V--D--L--L--Q--A--Q--S--Q--Q--L--Q--K--H--F--
CTCCGAGAAATTCTTGATGAGCTGCAGGCCCGCAAGCTGAAGCTGGAGTCCCAAGTGGATCTGCTGCAGGCTCAGAGCCAGCAACTGCAGAAACACTTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

><--------------------------------------------------------------------------------------------------
S--S--L--E--A--E--A--Q--K--K--Q--H--L--L--R--E--V--T--V--E--E--N--N--A--S--P--H--F--E--P--D--L--H--I
GCAGCCTGGAGGCTGAAGCTCAAAAGAAGCAGCACCTGTTGAGAGAAGTGACAGTTGAGGAAAATAATGCTTCCCCACATTTTGAGCCAGATCTCCATAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------><------------------------------------------------------------><---------
--E--D--L--R--K--S--L--G--T--N--Q--T--K--E--V--S--S--S--L--S--Q--S--K--E--D--L--Y--L--D--S--L--S--S-
TGAGGACCTGAGGAAATCCCTTGGAACAAACCAGACCAAAGAGGTGTCTTCTTCTCTCTCCCAGAGCAAGGAGGACTTATACTTGGACAGCCTGTCCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--N--V--W--H--L--L--S--A--E--G--V--A--L--R--S--A--K--E--F--L--V--Q--Q--T--R--S--M--R--R--R--Q--T--
CACAATGTCTGGCACCTCCTCTCTGCTGAGGGGGTAGCCCTCCGTAGTGCCAAGGAGTTCCTTGTGCAGCAGACACGCTCCATGCGGAGGCGGCAGACAG
            :::. :::::::::.:::::: :.::::::::.::.:::::::::::::: ::::.::::::.:::::::::::::::::::::::.:
------------CACTACCTCTCTGCCGAGGGGCTGGCCCTCCGCAGCGCCAAGGAGTTCCTGGTGCGGCAGACGCGCTCCATGCGGAGGCGGCAGACGG
-------------H--Y--L--S--A--E--G--L--A--L--R--S--A--K--E--F--L--V--R--Q--T--R--S--M--R--R--R--Q--T--

----------------------------------------------------------------------------------------------------
A--L--K--A--A--Q--Q--H--W--R--H--E--L--A--S--A--Q--E--V--A--K--D--P--P--G--I--K--A--L--E--D--M--R--K
CTCTGAAAGCTGCCCAGCAGCATTGGCGCCATGAGCTGGCCAGTGCGCAGGAGGTGGCCAAAGACCCACCAGGCATCAAGGCCCTGGAAGATATGCGCAA
:::::::.::.:: ::::::::.::::.:::::::::::::::::: :::::::..:::::::::::. ::::::.:: :::::::::.           
CTCTGAAGGCCGCACAGCAGCACTGGCACCATGAGCTGGCCAGTGCTCAGGAGGCAGCCAAAGACCCGGCAGGCACCATGGCCCTGGAG-----------
A--L--K--A--A--Q--Q--H--W--H--H--E--L--A--S--A--Q--E--A--A--K--D--P--A--G--T--M--A--L--E------------

------------><--------------------------------------------------------------------------------------
--N--L--E--K--E--T--R--H--L--D--E--M--K--S--A--M--R--K--G--H--N--L--L--K--K--K--E--E--K--L--N--Q--L-
GAACCTGGAGAAGGAGACCAGGCACCTGGATGAGATGAAGTCGGCCATGCGGAAAGGCCACAACCTGCTGAAGAAGAAAGAGGAGAAGCTGAATCAGTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------><------------------------------------------------------------------------------
-E--S--S--L--W--E--E--A--S--D--E--G--T--L--G--G--S--P--T--K--K--A--V--T--F--D--L--S--D--M--D--S--L--
GAGTCCTCTCTTTGGGAAGAGGCCTCAGATGAGGGCACTCTGGGAGGATCCCCCACCAAGAAGGCAGTAACCTTCGACCTCAGTGACATGGACAGCCTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------><---------------------------------------------------------------
S--S--E--S--S--E--S--F--S--P--P--H--L--D--S--T--P--S--L--T--S--R--K--I--H--G--L--S--H--S--L--R--Q--I
GCAGTGAAAGTTCTGAATCTTTTTCCCCGCCTCACCTCGACTCAACCCCGAGTCTCACCTCCCGCAAGATCCACGGGCTTAGCCACTCCCTCCGGCAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--S--Q--L--S--S--V--L--S--I--L--D--S--L--N--P--Q--S--P--P--P--L--L--A--S--M--P--A--Q--L--P--P--R-
CAGCAGCCAGCTGAGCAGTGTCCTCAGCATCCTGGACAGCCTCAACCCTCAGTCGCCGCCGCCGCTCCTCGCCTCCATGCCAGCCCAGCTCCCTCCCCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--P--K--S--T--P--T--P--T--Y--Y--G--S--L--A--R--F--S--A--L--S--S--A--T--P--T--S--T--Q--W--A--W--D--
GACCCTAAGAGCACCCCCACCCCCACCTACTATGGCTCCCTGGCCAGGTTCTCAGCCTTATCATCTGCTACACCCACGTCCACCCAATGGGCCTGGGATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------><---------------
S--G--Q--G--P--R--L--P--S--S--V--A--Q--T--V--D--D--F--L--L--E--K--W--R--K--Y--F--P--S--G--I--P--L--L
CAGGGCAGGGGCCCAGGCTCCCCTCCTCTGTGGCTCAAACGGTGGACGACTTCCTGTTGGAGAAGTGGCGCAAGTATTTTCCATCTGGCATCCCGCTGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------><------------------------------------------------
--S--N--S--P--T--P--L--E--S--R--L--G--Y--M--S--A--S--E--Q--L--R--L--L--Q--H--S--H--S--Q--V--P--E--A-
CAGCAACAGCCCCACCCCGCTGGAGAGCAGGCTGGGTTACATGTCTGCCAGTGAGCAGCTCCGGCTCCTACAGCACTCCCATTCGCAAGTCCCTGAGGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------><-------------------------
-G--S--T--T--F--Q--G--I--I--E--A--N--R--R--W--L--E--R--V--K--N--D--P--R--L--P--L--F--S--S--T--P--K--
GGCAGCACCACCTTTCAGGGCATAATTGAGGCCAACCGGAGGTGGCTGGAACGTGTCAAGAATGACCCCAGGTTACCTCTCTTCTCGTCAACACCCAAGC
                                                                              :::::::: :::...::::.::
------------------------------------------------------------------------------CTCTTCTCCTCAGTGCCCAGGC
-------------------------------------------------------------------------------L--F--S--S--V--P--R--

---------------------------------------------------------------------->
P--K--A--T--L--S--L--L--Q--L--G--L--D--E--H--N--R--V--K--V--Y--R--F--*-
CAAAAGCTACTTTGAGCCTCCTGCAGCTGGGCCTTGATGAGCACAACAGAGTGAAGGTGTATCGCTTCTGA
:.: ::::. ::. :::::::::::::::::::: ::::::   :::::: ::::::::::::::: ::::
CGACAGCTGGTTCCAGCCTCCTGCAGCTGGGCCTGGATGAG---AACAGACTGAAGGTGTATCGCTACTGA
P--T--A--G--S--S--L--L--Q--L--G--L--D--E-----N--R--L--K--V--Y--R--Y--*-

Pig Consensus Sequence

>BGISUST0000888453
GTCATGGCTGGAAGACCCATTCGCATAGGAGACCAGCTGGTTNTGGAGGAAGATTATGATGAGACCTACATCCCCAGTGAGCAA----------------
-----------------------------------------------------CGGGAGGGCATTGTGGCCCCACTGCCTGAAGAGTGGAAACCA---CA
GGACATCACAGGTGATATTTACTATTTCGCCTTTGCTAATGGGCAGTCCATGTGGGACCATCCCTGTGATGAGCACTATCGGAACTTGGCAGTCCAAGCG
TTGGGGAAGCTGTCAGCTCCTGGGGCCATTAAGAAGAAAGAAAAGAAAAAGAGCAAGAGG----------------------------------------
-----------------------------------------------------------------------------------CTGCGTGGATCTCAAAG
TGTGAGCCTGGGGAACTCGGTGGAGTCCAGTCAGCTTGGAGAACTC------CCATCAGAGGATCTCAAGACTTCTACTTATACAAAGGGTCTCTTGGGC
TCCTTCCATGGGGACAAGAATGCTCTCAGCCTCTTGGCTTTAGGGGAGGAGACTTATGAGGAGGATGAGGCAGAGAGTGACAAT---AGTGTCTGCAGCT
CAAGTGAGCTTCTTAAGAACCTGCACCTGGACATCAGGGCACTGGGGGGTGACTTTGAGTGTGAGGAATCTCCAAGAACAAGCCAGCCAGAGGAGAAAAA
GGACGTTTCTCTTGATTCAGATGCTGCCGGCCCCCCGACTCCTGACAAGGTCTTTAGCCAAGGTGCAGACGACAGCCTGAGCAGTGCCGATGGCAAAGGG
CGACCTGGAAGAGGGGCA----------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------GAGTCGGAGATTAGTGAACATATGAAGGAACTGAAGCTCTCAGACTCC
ACTGCTTCTGACCCCAAGTCCTTCCGTGGCCTG-------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------GCCGAGCACGAGGCTTCCCTGCAG
AGGCTGAGAGAAGAGTTGGAGTCTCTACAGAAAGCAGAGAGGGCCAGCTTGGAGAAGAGAAACAGGCAGACGCTGGAGAAGCTCAGGGAGGAGCTGGAGG
CTTCAGAGAAGAGAGAACAGGCCGCCATGAATGCGGAGAAGGAGCGGGCCTTGCGGCAGCTGAGACAGCAACTGGAAGGGGAGAGGAAAGAA------GC
GGCGCTGGAGAGGGAGCACAGGGAGGAGCTGGAGCGGCTCTCCGCCTCGCTGGAGGCCAAGCACGGAGAGGTGGTCTCCAGCCTCCAGAAGAAGATGGAA
GAAGCTCAGCAGAAAGAGAAGGCCCAGCTGCAGGAGAGCTGGGGCCGGGCGGAGCAGAGAGCTCATCGGAAGGCTCACCAGGTGCTTGAGTATGAGCAAG
AG--------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------GAAAGGAAACTCCAAGATTTAGAGGTGGAAC
TTGAAACCAGAACCAAGGACGTCAAGGCCAGATTGGCTCAGCTGGATGTTCAGGAGGCATCCGCCCGAAAGGAGAAGCAGCAGCTCCTCAATGTGCAGAG
GCAGGTTGCACTGGAGAGTGAG------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------CACTACCTCTCTGCCGAGGGGCTGGCCCTCCGCAGCGCCAAGGAGTTCCTGGTGCGGCAGACGCGCTCCATGCGGAGGCGGCAGACGGCTC
TGAAGGCCGCACAGCAGCACTGGCACCATGAGCTGGCCAGTGCTCAGGAGGCAGCCAAAGACCCGGCAGGCACCATGGCCCTGGAG--------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------CTCTTCTCCTCAGTGCCCAGGCCGA
CAGCTGGTTCCAGCCTCCTGCAGCTGGGCCTGGATGAGAACAGACTGAAGGTGTATCGCTACTGA


>BGISUSP0000888453
VMAGRPIRIGDQLV-EEDYDETYIPSEQ-----------------------REGIVAPLPEEWKP-QDITGDIYYFAFANGQSMWDHPCDEHYRNLAVQA
LGKLSAPGAIKKKEKKKSKR-----------------------------------------LRGSQSVSLGNSVESSQLGEL--PSEDLKTSTYTKGLLG
SFHGDKNALSLLALGEETYEEDEAESDN-SVCSSSELLKNLHLDIRALGGDFECEESPRTSQPEEKKDVSLDSDAAGPPTPDKVFSQGADDSLSSADGKG
RPGRGA------------------------------------------------------------------------------ESEISEHMKELKLSDS
TASDPKSFRGL-----------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------AEHEASLQ
RLREELESLQKAERASLEKRNRQTLEKLREELEASEKREQAAMNAEKERALRQLRQQLEGERKE--AALEREHREELERLSASLEAKHGEVVSSLQKKME
EAQQKEKAQLQESWGRAEQRAHRKAHQVLEYEQE------------------------------------------------------------------
-----------------------ERKLQDLEVELETRTKDVKARLAQLDVQEASARKEKQQLLNVQRQVALESE--------------------------
----------------------------------------------------------------------------------------------------
---HYLSAEGLALRSAKEFLVRQTRSMRRRQTALKAAQQHWHHELASAQEAAKDPAGTMALE--------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------LFSSVPRPTAGSSLLQLGLDENRLKVYRY*